KEGG   Micromonospora aurantiaca: Micau_2279Help
Entry
Micau_2279        CDS       T01296                                 

Definition
(GenBank) Aldehyde Dehydrogenase
Organism
mau  Micromonospora aurantiaca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2422704..2424146
Genome map
AA seq 480 aa AA seqDB search
MDLAAAPPALLTRRHLHVDGDWVDPSSGDTIPVENPATGSIVGEVPAGTPADVDRAVAAA
RAAFPGWAATAPEQRAAHLDRLHTALAARADEIARTVATELGTPLKLATRVQAGLPLTVL
RSIVDLAARPAAEHTVGNSLVVREPVGVVGAITPWNYPLHQVVAKVAPALAAGCTVVLKP
SELTPLTAYLLFDAITDAGLPPGVVNLVPGTGPVVGEALAAHPDVDLVSFTGSTATGRRI
AHLAAERIARVSLELGGKSANVILADADVPTAVKVGVGNALLNSGQTCTAWTRMLVHRDR
YAEALDLVAAAVAGYRLGDPFDPATRLGPLASAAQARRVRDHVDRALADGARLVAGGPDA
PLPPQGHFVAPTVFADVHPDSALAQEEVFGPVLAVIPFADTDEAVAVANNSRYGLAGAVW
SADSDAALAVARRMRTGQVDVNGGAFNPLAPFGGYKQSGLGRELGAYGVEEFTELKAIQR
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgccgccgcccctcccgccctgctgacgcgccgccacctgcacgtcgacggt
gactgggtcgacccgtcgtcgggcgacaccatcccggtggagaacccggccaccgggagc
atcgtcggtgaggtgcccgccggcacaccggccgacgtggaccgcgcggtcgccgccgcc
cgtgccgcgttccccggctgggccgccaccgcccccgagcagcgggccgcgcacctggac
cggctgcacaccgcgctcgccgcccgcgccgacgagatcgcccgcaccgtggcgaccgag
ctgggcaccccgctcaagctcgccacccgggtccaggccggcctgccgctgacggtgctg
cggagcatcgtcgacctggccgcccgcccggcggccgagcacacggtcggcaactcgctc
gtcgtccgggagccggtcggcgtggtcggcgcgatcaccccgtggaactacccgctgcac
caggtggtcgccaaggtcgcgcccgcgctcgccgccggctgcacagtggtgctcaagccc
agcgagctgacgccgctgaccgcgtacctgctgttcgacgcgatcaccgacgccgggctg
ccgcccggcgtggtgaacctggtgcccggcaccggcccggtggtcggcgaggcgctcgcc
gcgcaccccgacgtcgacctggtctcgttcaccggctccaccgccaccggccggcgcatc
gcccacctggccgccgagcggatcgcccgggtgtcgctggaactcggcggcaagtcggcg
aacgtcatcctggccgacgccgacgtgcccaccgcggtcaaggtcggcgtcggcaacgcg
ctgctcaactccgggcagacctgcaccgcctggacccggatgctcgtacaccgcgaccgc
tacgccgaggccctggacctggtcgcggcggcggtggccggctaccggctcggcgacccg
ttcgacccggccacccggctcggcccgctcgcctccgccgcgcaggcccggcgggtacgc
gaccacgtcgaccgggcgctcgccgacggcgcccggctcgtcgccggtggcccggacgcg
ccactgccgccgcaggggcacttcgtcgcgcccaccgtcttcgccgacgtgcacccggac
agcgcgctcgcccaggaggaggtgttcgggccggtgctcgcggtgatcccgttcgccgac
accgacgaggcggtcgccgtggccaacaactcccggtacgggctggccggcgcggtctgg
tccgccgactccgacgcggcgctggcagtggcccggcggatgcgtaccggccaggtggac
gtcaacggcggcgcgttcaacccgctcgccccgttcggcggctacaagcagtccggcctc
ggccgtgagctgggcgcgtacggcgtggaggagttcaccgagctgaaggcgatccagcgg
tga

DBGET integrated database retrieval system