KEGG   Micromonospora aurantiaca: Micau_4216Help
Entry
Micau_4216        CDS       T01296                                 

Definition
(GenBank) Alanine--glyoxylate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00250  Alanine, aspartate and glutamate metabolism
mau00410  beta-Alanine metabolism
mau00640  Propanoate metabolism
mau00650  Butanoate metabolism
mau01100  Metabolic pathways
mau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Micau_4216
   00650 Butanoate metabolism
    Micau_4216
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Micau_4216
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Micau_4216
Enzymes [BR:mau01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Micau_4216
Amino acid related enzymes [BR:mau01007]
 Aminotransferase (transaminase)
  Class III
   Micau_4216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADL47729
JGI: Micau_4216
UniProt: D9T3Q0
LinkDB All DBs
Position
complement(4781955..4783250)
Genome map
AA seq 431 aa AA seqDB search
MTSDDLLARHRAVLPSWMPLYYAEPLELVAGSGRRVTDAAGRTYLDFFGGVLTTMVGHDI
PEIREAVEQQLRTGLVHTSTLYLIRQQVELAEKIARLSGIPDARVFFTNSGTEANEAALL
VATNHRRSHQILAVRNSYHGRSYATMGVTGNRGWSASALNPLQVAWLHSGERLRGLLARL
DAADRVDAAVEDLREVLATQTAGDVACLIAEPVQGVGGFVHGPDGLFAAWKKVLDEHGIL
LISDEVQTGWGRTGEHFWGYQAHGVTPDLLTFAKGIGNGFALAGVVGRAEVLESVPAISF
STFGGNPVSTAAGNAVLDYLLDHDLQGNAARVGAILGDGLRAAVAGLDQVAEVRGKGLML
AVEFVHPGTVEPDAELTTRVFEACRASGLLVGKGGLYGNVIRMGPPLTLTEDEAREGLAI
MVDAIRASIEA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgacgacctgctggcccggcaccgggccgtgctcccctcctggatgccgctc
tactatgccgaaccgctggaactcgtcgccggttccggccgccgggtcaccgacgcggct
ggccggacctatctggacttcttcggcggggtgctgaccacgatggtcggccacgacatc
ccggagatccgggaggcggtcgaacaacagctgcggaccgggctcgtgcacacctcgacg
ctctacctgatccggcagcaggtcgagctggccgagaagatcgcccggctctccggcatc
ccggacgcccgcgtgttcttcaccaactccggcaccgaggcgaacgaggccgcgctgctg
gtcgccacgaaccaccggcgctcgcaccagatcctcgcggtgcgcaacagctaccacggc
cggtcgtacgcgacgatgggcgtcaccggcaaccgcggctggtcggccagcgccctcaac
ccgttgcaggtggcctggctgcactccggtgaacggctgcgcggactgctggcccggctc
gacgccgccgaccgggtcgacgcggcggtcgaggacctgcgcgaggtgctcgccacccag
accgcgggcgacgtggcctgcctgatcgccgagccggtccagggtgtcggtggcttcgtg
cacggaccggacgggctcttcgccgcctggaagaaggtgctcgacgagcacggcatcctg
ctgatcagcgacgaggtgcagaccgggtgggggcgtaccggcgagcacttctggggctac
caggcgcacggcgtcacgccggacctgctcacgttcgccaagggcatcggcaacgggttc
gcgctcgccggggtggtcggccgggccgaggtgctggagtcggtgccggcgatcagcttc
tccacgttcggcggcaacccggtctccaccgccgccggcaacgcggtgctcgactacctg
ctcgaccacgacctgcagggcaacgccgcccgggtcggcgcgatcctgggcgacggcctg
cgcgcggccgtcgccggactggaccaggtcgccgaggtacgcggcaagggcctgatgctc
gccgtcgagttcgtccacccgggcaccgtcgagccggacgcggagctgaccacccgcgtc
ttcgaggcgtgccgggccagcggcctgctcgtgggcaagggcggcctgtacggcaacgtg
atccggatgggcccgccgctgacgctcaccgaggacgaggcccgggagggtctggcgatc
atggtcgacgcgatccgcgcctcgatcgaggcgtga

DBGET integrated database retrieval system