KEGG   Mycobacterium avium 104: MAV_3879Help
Entry
MAV_3879          CDS       T00433                                 

Definition
(GenBank) glycosyl transferase, group 1 family protein
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
mav  Mycobacterium avium 104
Pathway
mav00500  Starch and sucrose metabolism
mav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAV_3879
Enzymes [BR:mav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MAV_3879
Glycosyltransferases [BR:mav01003]
 Polysaccharide
  Storage polysaccharide
   MAV_3879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_transf_5 Glyco_trans_4_4 Glyco_trans_1_2 Glycogen_syn
Motif
Other DBs
NCBI-ProteinID: ABK67158
UniProt: A0A0H2ZZI2
LinkDB All DBs
Position
4009209..4010465
Genome map
AA seq 418 aa AA seqDB search
MKILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDPRTHPSTDQISEG
VRVIAAAQDPHEFTFGTDMMAWTLAMGHAMIRAGLPPKLHDKKPGGNRPWRPDVVHAHDW
LVAHPAIALAQFYDVPMVSTIHATEAGRHSGWVSGPISRQVHAIESWLVRESDSLITCSA
SMADEITELFGPGLAQITVIRNGIETARWPFAPRRPRTGPAELLYLGRLEYEKGVHDVIA
ALPRIRRTHPGTTLTIAGEGTQQGWLIEQARKHRVLKAIRFVGHLEHSELLAMLHRADAA
VLPSHYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGQTGVSCPPRDVPALAAAIRTVL
DDPEAAQRRACAARERLTSDFDWHTVADKTAQVYLSAKRAERQPQARLPIVEHALPDR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctgatggtgtcgtgggagtacccgccggtggtcatcggcgggctgggccgg
cacgtgcatcacctgtccaccgcgctggccgcggccggccacgacgtcgtcgtgctgtcc
cgccgccccaccgggaccgacccgcgcacccacccgtcgaccgaccagatcagcgagggc
gtccgggtgatcgcggccgcgcaggacccgcacgaattcaccttcggcaccgacatgatg
gcctggacgttggcgatggggcacgccatgatccgcgccgggctgccccccaaactgcac
gacaagaagccgggcggcaaccgcccctggcgtcccgacgtcgtgcacgcgcacgactgg
ctggtggcccatcccgcgatcgcgctcgcccaattctacgacgtgccaatggtttccacc
atccacgccaccgaagcgggtcggcattccggttgggtcagcgggccgatcagccgtcag
gtgcacgcgatcgagtcgtggctggtccgcgaatccgattcgctgatcacctgttcggcg
tcgatggccgacgagatcaccgaactgttcggccccgggctggcccagatcacggtgatc
cgcaacggtatcgagaccgcccgctggccgttcgcgccgcgccggccgcgcaccgggccg
gccgagctgctgtatctgggacggctcgagtacgagaagggcgtgcacgatgtcatcgcc
gcgctgccccgcatccggcgcacccacccgggcaccacgctgaccatcgccggcgagggc
acgcagcagggctggctgatcgaacaggcgcgaaaacaccgggtgctcaaggcaatccga
ttcgtcggccacctcgaacactccgagctgctggcgatgctgcaccgcgccgacgccgcg
gtgctgcccagccactacgagccgttcggcatcgtggcgctcgaggcggccgcggccggc
actcccctggtcacgtcgaacatcggcggcctgggcgaggcggtgatcgacggccagacc
ggcgtctcgtgcccgccccgcgacgtgcccgcgctggccgcggcgatccgcaccgtgctc
gacgatccggaggccgcgcagcggcgcgcctgcgccgcccgggaacggctcacctcggac
ttcgactggcacacggtggccgacaagaccgcgcaggtgtacctgtccgccaagcgggcg
gaacggcagccgcaggcccggctgcccatcgtcgaacacgccttgcccgaccggtag

DBGET integrated database retrieval system