KEGG   Mycobacterium avium subsp. avium 2285 (R): LA63_20305Help
Entry
LA63_20305        CDS       T03342                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mavr  Mycobacterium avium subsp. avium 2285 (R)
Pathway
mavr00250  Alanine, aspartate and glutamate metabolism
mavr00410  beta-Alanine metabolism
mavr00430  Taurine and hypotaurine metabolism
mavr00650  Butanoate metabolism
mavr01100  Metabolic pathways
mavr01110  Biosynthesis of secondary metabolites
mavr01120  Microbial metabolism in diverse environments
mavr02024  Quorum sensing
Module
mavr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mavr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LA63_20305
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LA63_20305
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LA63_20305
   00430 Taurine and hypotaurine metabolism
    LA63_20305
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LA63_20305
Enzymes [BR:mavr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LA63_20305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIR58275
LinkDB All DBs
Position
complement(4291134..4292513)
Genome map
AA seq 459 aa AA seqDB search
MPQHPSLPAHAIAPAYTGRLFTAPVPALRMPDESMDPDAAYRFIHDELMLDGSSRLNLAT
FVTTWMDPEAGRLMAETFDKNMIDKDEYPATAAIEQRCVCMVADLFHAEGLNDADPYSAC
GVSTIGSSEAVMLGGLAMKWRWRAKTKDWKKRTPNLVMGSNVQVVWEKFCRYFDVEPRYL
PMEEGRYVITPEQVVDAVDEDTIGVVAILGTTYTGELEPVADICGALDKLAARGGVDVPV
HVDAASGGFVVPFLHPELKWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRSKEYLPDELV
FRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQTLSGTARWLGEQLRVS
EHCELISDGSAIPVVAFRLAKDRGYTEFDVSHELRTYGWQVPAYTMPDNATDVSVLRIVV
REGLSADLARALHDDAVSALTSLDKVKPGGHYDAQHFAH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgccccaacatccttcgctgcccgcgcatgccattgccccggcctacaccggccggctg
ttcaccgcgccggtgcccgcgctgcggatgcccgacgagtcgatggatcccgacgccgcc
taccggttcatccacgacgagctgatgctcgacggcagctcccggctgaacctggccacc
ttcgtcaccacctggatggaccccgaggccgggcggttgatggccgagacgttcgacaag
aacatgatcgacaaggacgaatacccggccaccgcggccatcgagcagcgctgcgtgtgc
atggtcgccgacctgttccacgccgaaggtctgaacgacgccgacccgtacagcgcctgc
ggggtgtccaccatcgggtccagcgaggcggtgatgttgggcgggctggcgatgaagtgg
cggtggcgcgccaagaccaaggactggaagaagcgcaccccgaacctggtgatgggctcc
aacgtccaggtggtctgggagaagttctgccgctacttcgacgtcgagccccgctacctg
ccgatggaggagggccgctacgtcatcacccccgaacaggtcgtcgacgccgtcgacgag
gacaccatcggcgtggtggccatcctgggcaccacctacaccggcgagctggaaccggtc
gccgacatctgcggcgcgctggacaagctggccgcgcgcggcggcgtggacgtcccggtg
cacgtcgacgccgccagcggcgggttcgtggtgccgttcctgcaccccgagctcaagtgg
gacttccggctgccccgggtggtgtcgatcaacgtcagcgggcacaagtacgggctgacc
tatcccggcgtcggcttcgtggtgtggcgcagcaaggagtacctgcccgacgagctggtg
ttccgggtcaactacctgggcggcgacatgccgaccttcacgctgaacttctcgcgcccc
ggcaaccaggtggtcggccagtactacaacttcctgcggctgggccgcgagggctatacc
aaggtgatgcagacgctgtccggcacggcgcgctggctgggcgagcagctgcgggtcagc
gagcactgcgagctgatctcggacggctcggcgatcccggtggtcgccttccggctggcc
aaggaccgcggctacaccgagttcgacgtctcccacgagctgcgcacctacggctggcag
gtgcccgcctacaccatgcccgacaacgccaccgacgtctcggtgctgcgcatcgtggtg
cgtgaggggctgtcggccgacctggcccgggcgctgcacgacgacgccgtctcggcgcta
acctcgctggacaaggtcaagccgggcggccactacgacgcccagcacttcgcgcactga

DBGET integrated database retrieval system