KEGG   Metarhizium acridum: MAC_02975Help
Entry
MAC_02975         CDS       T03104                                 

Definition
(RefSeq) hexokinase
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
maw  Metarhizium acridum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:maw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAC_02975
   00051 Fructose and mannose metabolism
    MAC_02975
   00052 Galactose metabolism
    MAC_02975
   00500 Starch and sucrose metabolism
    MAC_02975
   00520 Amino sugar and nucleotide sugar metabolism
    MAC_02975
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MAC_02975
Enzymes [BR:maw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     MAC_02975
Membrane trafficking [BR:maw04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    MAC_02975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 486 aa AA seqDB search
MANNLAAGSKADIPQDLLNEVKRLEDLFTVDTQTLKKITDHFISELAKGLSVEGGSIPMN
PTWVMSFPDGYETGTFLALDMGGTNLRVCQITLTEQKSEFDILQSKYRMPEELKTGNSDE
LWEYIADCLQQFVETHHGGCAGIGTLPLGFTFSYPATQNYIDEGILQRWTKGFDIAGVEG
QNIVPMLNAALEKKGVPIRLTALINDTTGTLIASAYTDPKMKIGCIFGTGCNAAYMEDVG
SIPKLAHMKLPPETPMAINCEWGAFDNEHKVLPRTEFDKIIDRDSPRPGQQAFEKMIAGL
YLGEIFRLVMVDLHDNRDVHVFAGQDISLLRKAYSLDSSFLSAVEEDPFENLQETFDLFS
SKLNITCSRPELELIRRLAELIGTRAARLSATGVAAICKKKDFKTCHVGADGSVFNKYPQ
FKERGAQALREILDWPEKKNPKEEDPIEILAAEDGSGVGAALIAALTLKRVKAGNVAGVL
HPEHFK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaatctcgcggcaggctcgaaggcggatattccccaggatctgctcaacgaa
gtcaagaggctcgaggatctcttcacagttgacacacagacgctcaagaaaattacagac
catttcatttccgagttggccaagggtcttagtgtcgagggtggcagcattccaatgaac
ccaacctgggtcatgtcattccccgatggctatgaaaccggcaccttccttgctcttgac
atgggcggcaccaacctccgtgtgtgccagattaccctgaccgaacagaaatccgaattt
gatatccttcagtccaagtatcgcatgccagaggagctcaaaaccggcaactcggatgag
ctttgggaatatattgcggactgtctgcagcagtttgtagagactcaccacggcggttgc
gctggcattggcacccttcctcttggtttcaccttctcgtatccagcaacacagaactac
attgacgagggtattcttcagagatggaccaaggggttcgacattgctggtgtcgaaggg
cagaatattgttccaatgttgaacgctgctctcgagaagaagggagtgcccatcaggctt
actgctctgatcaacgatacgacgggaactctgatagcttccgcatacactgacccaaag
atgaagattggctgtatctttggcaccggctgcaatgctgcctatatggaggatgttggc
tctattcccaaactagcacacatgaagctgccaccagagactcccatggctatcaactgc
gagtggggtgctttcgataacgagcacaaggtgctgcctaggactgagtttgacaagatt
attgaccgtgattcaccccggccaggtcagcaggcctttgagaaaatgattgctggtcta
tatcttggcgaaattttccgacttgtcatggttgatttgcacgacaatcgcgacgtacat
gtctttgccggccaggatatttccctgctgcgcaaagcttattctctggattcctctttc
ctttctgctgttgaagaggatccttttgagaatttgcaggagacgtttgacctattcagc
tccaaactcaacattacttgctccagaccagaattggagctcattcgacggctcgccgag
cttatcggcactcgtgctgctcgcctctctgccactggtgttgctgccatctgcaagaag
aaggactttaagacctgccatgtcggtgctgatggatccgttttcaacaagtacccacag
ttcaaggaacgtggtgcccaggctctccgtgagattcttgactggcctgaaaagaagaat
cccaaggaagaggatcctattgagattcttgctgccgaggacggtagcggtgtaggcgcc
gctttgattgcggcgttgactctgaagagagtcaaggctggcaatgttgctggagtgctg
catccagagcacttcaaataa

DBGET integrated database retrieval system