KEGG   Mycobacterium abscessus subsp. bolletii 103: LA61_12770Help
Entry
LA61_12770        CDS       T03329                                 

Gene name
katE
Definition
(GenBank) hydroperoxidase
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
maz  Mycobacterium abscessus subsp. bolletii 103
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:maz00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LA61_12770 (katE)
  Amino acid metabolism
   00380 Tryptophan metabolism
    LA61_12770 (katE)
Enzymes [BR:maz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     LA61_12770 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2561795..2563903)
Genome map
AA seq 702 aa AA seqDB search
MDRTSNPKQEQLDTSRVDRASGYLTTQQGVRVDHTDDALTAGVRGPTLLEDFHAREIVTH
FDHERIPERVVHARGAGAYGYFEPYDAWLSDFTAAKFLTTPGLRTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTQQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPDNEIPQAASA
HDTLWDFVAEQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFRLVNDAGEGVFVKFHWKP
LLGVHSLLWDECQQIAGKDPDFNRRDLWDAIESGQFPEWELGVQLVPESDEFKFPFDLLD
STKIIPEEQVPVQPVGRMVLDRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPIAEVHNNQRDGFAQHDIPQGKSSYFKNTLGGGCPALAHE
DVFRHYTQRVDGHKIRQRAESFKDFYSQPRMFWNSMSAVEAQHIVSAFSFELGKVSAEAG
IRERVVAQLNLVEHDLASQVALQLGLPAPAPQSADEALPPSPALSQLSTTRDSIATRRIA
VLAADGVDIHGVELLRAALEESDAIVEILAPTGGGTLTGESGGELRVDRAMTTMASVLYD
AVVVPSGAESAWRLARNGFAVHFVSEAYKHLKPVAAYGSGLDLLRAASVVETLATTTEIV
VDDGVVTTTAEANALPAEFVAAFVTAISRHRAWERETEMVPA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtggaccgcacgtcgaatcccaaacaagagcaactcgacacgtcccgggtggaccgagcc
tctggttatctcactacccagcaaggcgttcgcgtcgaccacaccgatgacgcgctcacc
gccggtgtcaggggccccacgctgctggaggattttcacgcccgcgagatagtcacgcat
tttgaccacgagcgcattccagagcgtgtggttcatgcgcgcggcgcgggcgcatacggc
tacttcgagccgtacgacgcgtggctatcggacttcacagccgcgaaatttctcaccaca
cccggcctgcgcacaccggtgttcgttcgtttctctaccgttgcggggtcccgcggctcg
gcagacaccgtgcgcgacgtacgcggatttgccacgaaattctatacacagcaaggcaat
tacgatctggtcggcaacaatttcccggtattctttatccaggacggcatcaaatttccg
gacttcgtgcacgcggtgaagcctgagcccgacaacgagatcccgcaggccgcctcggcg
catgacaccttgtgggacttcgttgccgagcagcccgagacgctacacgcgatcatgtgg
ctcatgtccgatagggctctgccccgcagctaccgcatgatgcaagggttcggcgtacac
accttccggttggtcaacgacgccggcgagggcgtttttgtgaagttccactggaagccg
ctgctgggcgtgcactcactgctgtgggacgaatgtcagcagatcgccggcaaggacccc
gatttcaaccggcgcgatctctgggacgcgattgagtccggccagtttccggaatgggaa
ctcggagtgcagctggtgccggaatccgacgagttcaaattccccttcgaccttcttgat
tcaacgaaaatcattccggaagaacaggttccggtgcagccggtcggacgcatggtgctg
gatcggaaccccgacaacttctttgccgagacagaacaggtcgcattccacacggccaac
gtggtgccgggaatcgacttcaccaacgacccgctgcttcagtttcgtaacttctcctac
ctggatacacaactgatccgcctgggcggtccgaacttcgcacaactgcccatcaacaga
ccgatcgccgaggtacacaacaaccagcgagacggcttcgcgcagcatgacatcccacaa
ggcaagtccagctatttcaagaacaccctcggcggcggctgtccggccctggcacatgaa
gatgtcttccgccactacacccaacgagtggacggacataagatccgccagcgcgccgag
agcttcaaggatttctacagccagccgcggatgttctggaacagtatgtccgccgtcgag
gcgcagcacatcgtttcggcattctcgttcgaactgggcaaggtgagtgccgaggccggg
attcgcgaacgtgttgtcgctcaactcaacctggtggaacacgatcttgcttctcaagtc
gccttgcagctgggcttacccgccccagcgccgcaatcggccgacgaggctcttccaccg
tccccggcgctgtcccagctttccaccacccgagacagcatcgccacccgacggatcgcg
gtgctcgcggccgacggcgtcgatattcacggcgtggagttgcttcgtgcggcgctggaa
gagagcgacgcgattgtcgagatactcgcaccgactggcggcggaacgctcaccggcgaa
tccggcggcgaactccgcgtcgaccgcgcgatgaccacgatggcctcggtgttatacgac
gccgtagtcgtaccctccggagccgaatccgcctggcggctggcgcgcaacggcttcgcc
gtgcatttcgtttccgaggcctacaaacatctcaagcccgtcgcggcctacggttccgga
ctcgatctgctccgggcagcctctgtggtcgaaacacttgccaccaccacggagattgtg
gttgacgacggcgtggtgacgaccaccgcggaggccaatgcattgccggccgaattcgtg
gccgcgtttgtcacagcgatcagccggcatcgcgcctgggaacgcgagaccgagatggtg
cccgcatag

DBGET integrated database retrieval system