KEGG   Mycobacterium abscessus subsp. bolletii 103: LA61_18095Help
Entry
LA61_18095        CDS       T03329                                 

Definition
(GenBank) acyl-CoA synthase
Organism
maz  Mycobacterium abscessus subsp. bolletii 103
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3609745..3611490)
Genome map
AA seq 581 aa AA seqDB search
MQTTYDFTDYFSTVTEWVARQPDQIALGYLEEGAGELTERAWTYAELVSHATAVAARLRE
DLEPGDRTLLLYPPGLPFVAAFLGCLAAGVVAVPAPLPDGRDKAQHRLAGIIADAGTRVV
LTESSVAPLIAGWADALPTPIALIATDAIPVELGREFVPVRSAPSDTAFLQYTSGSTNAP
KGVIVTHGNLVHNEQELGARIENDPSFSMLSWLPQFHDMGLIGMLLWPLFYGGTSRFLSP
VTFIKHPIQWIRAMSKYRATVGVAPNFAFDLVARRCTHEALEGVDLSCVRSLLNGSEPVQ
WASIERFTTLLAPFGLAEHAVTPVYGLAEATLFVTGDPHGTPVTTAVVDGEALAENRLVV
ANEGAPRSRVLVASGRIGGIEVSVVGADGAPLPDGEIGEIWLRGTSVAAGYWNLPELSAE
IFGATPIGGTGGWLRTGDLGTLVDGNLFITGRTKDVIIVNGRNLYAHDIEAAARAAAPAL
ARGVGAAFAVGTPERLVLVHEIRPENLGDASLDDVLAAVRTAIFAEFATPLSDLVLVAKG
EVARTTSGKIRRTHMRASYEGGRITAFADPRLASAGGDVVR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgacgtacgatttcaccgactacttcagcaccgtcaccgaatgggttgcccga
caaccggatcagattgccctgggctacctggaagaaggtgcgggcgaactgacggagcgc
gcgtggacctacgccgaactcgtaagtcatgccaccgccgtggccgcacgtcttcgtgaa
gacctggagcccggggaccgtaccctgctgctgtatccgcccgggctaccctttgtcgcg
gcgtttcttggctgcttggctgccggagtggttgcggttcccgctccactgcccgatggt
cgtgacaaggcgcagcaccgtcttgccggcatcatcgcggacgcgggcacacgcgttgtg
ctgacggagtcgtcggttgcgccacttatcgcgggctgggccgacgcgctgcccacgccg
atcgcgctcatcgccaccgatgcgattcccgtcgagctggggcgcgaattcgttccggtg
cggtcggcgccttccgataccgccttcctgcagtacacgtcgggttcgaccaatgccccg
aagggtgtgatcgtcacccacgggaacctcgtccacaacgagcaggaactcggagcccgc
atcgagaatgacccgtcgttctcgatgctcagctggctgccgcagtttcatgacatgggc
ctgatcggcatgctgctctggccgttattctacggcggcacttcgcgtttcctgtcacct
gtgacgtttatcaagcatcccatccagtggatccgggccatgtcgaagtaccgggcgacc
gtaggagtggcaccgaacttcgccttcgacctggtggcacggcgctgcacgcacgaggcg
ctcgagggtgtcgatctgtcgtgcgtacggtcgctactcaacggatcggagcccgtgcag
tgggcttctatcgagcggttcaccacgctgctggctccgttcggactcgcggagcatgcg
gttaccccggtgtatgggcttgccgaagccacgttgttcgtgaccggcgatccgcacggc
acgccggtcaccaccgccgttgtcgacggtgaggcgcttgccgaaaatcggttggtggtc
gccaacgaaggcgcgccacggtcccgagtgctggttgccagcggccgcatcggtggtatc
gaagtttcggtcgtcggagccgacggtgcacctctgcccgacggcgaaatcggcgagatc
tggctgcgcggaacgagtgtggccgctgggtattggaaccttccggagttgtccgccgag
atattcggcgcgacaccgatcggcggcacgggcggctggttgcgtaccggggacctgggc
accctggtcgatggcaacctcttcatcaccggtcgcaccaaggacgtcatcattgtcaac
ggccgcaatctctacgcccatgacatcgaggcggccgcgcgtgcggccgccccggccctg
gcacgcggggtgggcgcggcattcgcggtcggcacccctgagcggctcgtgctggttcac
gagatccgcccggagaatcttggtgatgcctcccttgacgacgtgctcgcggcggtacgc
accgcgatattcgccgaattcgccaccccgctgagcgatttggtgctggtggccaagggg
gaggtagcccgtaccaccagtggcaagatccgtagaacccatatgcgagcctcctatgag
gggggccggatcacggcgttcgcggatccgcggctggcctccgccggcggggacgtcgtc
cggtga

DBGET integrated database retrieval system