KEGG   Mycobacteroides abscessus subsp. bolletii 103: LA61_22320Help
Entry
LA61_22320        CDS       T03329                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
maz  Mycobacteroides abscessus subsp. bolletii 103
Pathway
maz00250  Alanine, aspartate and glutamate metabolism
maz00410  beta-Alanine metabolism
maz00640  Propanoate metabolism
maz00650  Butanoate metabolism
maz01100  Metabolic pathways
maz01120  Microbial metabolism in diverse environments
Module
maz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:maz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LA61_22320
   00650 Butanoate metabolism
    LA61_22320
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LA61_22320
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LA61_22320
Enzymes [BR:maz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LA61_22320
Amino acid related enzymes [BR:maz01007]
 Aminotransferase (transaminase)
  Class III
   LA61_22320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF982
Motif
Other DBs
NCBI-ProteinID: AIR35569
LinkDB All DBs
Position
complement(4479357..4480634)
Genome map
AA seq 425 aa AA seqDB search
MPVGLRASGSSATALSPVLKQATPVVAARGQGCYLYDETDREYLDFTAGIGVVSTGHCHP
RVVEAAQRQVATLIHGQYTTVMHRPLQNLVRRLGEVLPPSLNSLFFANSGSEAVEAAVRL
ARQATGRPNIIVFQGGFHGRTLAAATMTTSGPRFSSGIGPLMAGVYSAPFPTAYRYGWSE
AEATRFALQELDYLFATATAPGQVAAMVIEPVLGEGGYIPANTEFLTGIAERAREHGILL
VLDEVQTGFGRTGQYFGHQHFGVTPDVLVMAKGIASGFPISGIAASAELMGRAWPGSQGG
TYGANAVACAAALATLDVIDEEGLVDNARARGQELLDGARKIAADRGIDGDVRGLGLMVG
VEFSQDGRPAPQRAARAQAAAAENGLLLLMCGPHMNVVRMIPPLVVTADQISDALGIWSS
VVAGL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcggtcttcgcgcaagcggctcatccgcaaccgcgctatcacccgttctcaag
caggccaccccagtggtggcggcgcgaggccagggttgctatctgtacgacgaaacagac
cgcgaatacctggatttcaccgcgggaatcggtgtggtgagcaccggccattgccatccg
cgcgtggtcgaggccgcgcagcggcaggtagccaccctcatccacgggcagtacacgacg
gtgatgcaccgcccgctgcagaatttggtgcggcgcctcggcgaggtactgccgcctagc
ctgaattcactgtttttcgccaactccggcagtgaagccgtcgaggctgccgtgcggctg
gcgcgtcaggccaccggacgtcccaatatcattgtgttccagggcggatttcatggccgc
acactggccgccgccacgatgaccacctccggcccgcggttctcatcgggaatcggtcca
ctgatggcgggtgtatacagcgctcccttccccacggcgtatcggtacggctggagcgag
gccgaggccacacggttcgcgctacaagagctcgactacctgttcgcgacggccaccgcc
ccgggccaggtcgcggcgatggtcatcgagccggtgctcggcgagggtggctacatcccc
gccaacaccgaattcctcaccggcattgccgagcgcgcgcgcgagcatggcatcctcttg
gtcctcgacgaggtgcagaccggattcgggcgcaccgggcaatacttcgggcaccagcat
ttcggcgtcacaccggatgttctggtgatggccaagggaatcgcgagcggattccccatc
tcgggcatcgctgcctccgccgagttgatggggcgtgcctggccgggttcgcagggcggc
acctacggggccaacgccgtcgcatgtgccgctgcgctggccactctcgatgtgatcgac
gaggagggcctcgtcgacaatgcgcgtgcgcggggccaggaacttctggatggggctcga
aagatcgccgctgacagaggaatagatggggacgtacgcggcctcggactgatggttggc
gtggagttcagccaggatggccgaccggcaccgcaacgtgcggcgcgggcacaggcagca
gccgccgagaacggtctattgctactcatgtgcggcccgcacatgaacgtggtgcgcatg
attccgccgctggtggtgacggccgatcagatatccgatgccctcggtatctggagcagt
gtggtggcggggctgtga

DBGET integrated database retrieval system