KEGG   Methanosarcina barkeri Fusaro: Mbar_A0537Help
Entry
Mbar_A0537        CDS       T00271                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00500  Starch and sucrose metabolism
mba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mbar_A0537
Enzymes [BR:mba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Mbar_A0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57
Motif
Other DBs
NCBI-ProteinID: AAZ69518
JGI: MbarA0537
UniProt: Q46F24
LinkDB All DBs
Position
1:639023..640159
Genome map
AA seq 378 aa AA seqDB search
MKAVCICMGVHLPYSPKWYWPVEGFFGVPEMDRYFDRNNIFSKFIKTSRQFLRLNDLIME
SIERGGKYSFDLSGPFLGQCRWDPELLESFREFGENGNVEFTGSCRYHSLSSLYPDLSWF
KEEVLIYREMLRELLDITPKTFVNTELLYTERVEKILTDLGFNCLISEGSRNLLNGYDPV
HVFENHLPTLLRHINLSEDLELRFSEKNWQGYPLIPEKFADWIASMEGDILTLYFNYTSL
CFHYRNKSMIDDFIRMLPEALKSRGIDMLTPSEAVRRFEPLKLPTLGTEQTIRYGMNNAL
GNHAQQLYLRELVRIEEELSELKENKNYRELKHIFGYLQQSEIFFSMNSGNLREGYERAV
NYFSILSDFRRAVLEERE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtatgcatctgtatgggagtgcatctgccttacagtcccaagtggtactgg
cctgtagagggatttttcggggtgcctgaaatggaccggtattttgaccggaacaatatt
ttttcaaaatttataaaaacaagccgacagtttttacgccttaatgatctgattatggag
tccatagaaagagggggaaaatactcctttgatctatccgggccattccttggacaatgt
agatgggaccccgaacttctcgagtcattccgcgaatttggagaaaatgggaacgtggaa
ttcacagggagctgcagatatcactccctgagttcattatatcccgatctttcctggttt
aaggaagaagtactaatatacagagaaatgcttcgggaattactggatatcacccccaaa
accttcgtaaacacagagcttctgtacactgaaagagtagagaagattcttaccgacctg
ggctttaactgccttatctccgaggggtccaggaacctcctgaatggatatgatcctgta
catgtctttgagaaccatcttccgactttgctgaggcacataaacctgagcgaagacctt
gaactgcgtttttcggaaaaaaactggcaaggctaccctcttattccggaaaagtttgca
gactggattgctagcatggaaggtgacatcctgaccctttattttaattatacaagcctt
tgctttcactacaggaataaaagtatgatagacgattttatcaggatgcttccagaagcc
ctaaagtccaggggcattgacatgctcacaccttctgaagctgtcaggagatttgaaccc
ttaaaacttcctaccctgggaaccgaacagacaattcgttacgggatgaataacgcatta
ggtaaccatgctcagcagctttacctgcgagaactggtaagaatcgaagaggaactctca
gagcttaaagaaaataagaactatcgagaacttaaacatatattcggttatcttcagcag
agtgaaatctttttttctatgaattctgggaatctcagggaagggtatgaaagagctgtc
aattacttttccatcctttccgatttcaggagagctgtgctggaggagagagaatga

DBGET integrated database retrieval system