KEGG   Methanosarcina barkeri Fusaro: Mbar_A1899Help
Entry
Mbar_A1899        CDS       T00271                                 

Definition
(GenBank) DNA ligase (ATP)
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba03030  DNA replication
mba03410  Base excision repair
mba03420  Nucleotide excision repair
mba03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mba00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Mbar_A1899
   03410 Base excision repair
    Mbar_A1899
   03420 Nucleotide excision repair
    Mbar_A1899
   03430 Mismatch repair
    Mbar_A1899
Enzymes [BR:mba01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mbar_A1899
    6.5.1.6  DNA ligase (ATP or NAD+)
     Mbar_A1899
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Mbar_A1899
DNA replication proteins [BR:mba03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Mbar_A1899
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Mbar_A1899
DNA repair and recombination proteins [BR:mba03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Mbar_A1899
   NER (nucleotide excision repair)
    Other NER factors
     Mbar_A1899
   MMR (mismatch exicision repair)
    Other MMR factors
     Mbar_A1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AAZ70839
JGI: MbarA1899
UniProt: Q46BA3
LinkDB All DBs
Position
1:2366157..2367863
Genome map
AA seq 568 aa AA seqDB search
MTSFREFAETCQAIEKISSTIDTTSRVADLLKKVDVEELPIATHFIMSEVFPAWSGEQLG
IGTSLLYVSLSKASGMPVKSIESLIRTTGDIGDTALLILKEKRKNQVTFSSFFEEQPELS
ITEVYNRFKIASEASGKGSQDIKIKNLQFLFTSSTPREAKYISRLALEELRIGVGEGVVR
DAIAKAFSVPVDVVEHAFMVTNDLGIVAATAKDGGVEALESLGIEINRPIKMMLSQISPD
IVADIKEMKEAAIEWKFDGARVQVHKAGDSVMLFSRKLENVTNSLPDLVEIIRKHVKAES
AILDGEAVAVDENGRPRAFQEILKRFRRKYDVEEKALGIPIQLNLFDIMYLNGKTLIDLP
LIERRKALESCVESSVEDSKSISVDKQVITGDLDLIEKIYKEALDAGHEGVMVKNPNSFY
SPGKRGKNWLKKKPLMETLDLVVVGAEWGFGRRANLLGSYTVACYDPKTLRFLQVGKVGT
GLTDDQLKELTEILSGLMEGGEAGGIFAIRPKIVLEIAFEEIQKSPNYDSGFALRFPRFI
RIRDDKDPEEADTIQRIGKVYSQQLKRL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtttcagggaatttgcagaaacctgccaggcgattgaaaaaatctcgagtaca
attgatactacaagtcgggttgctgaccttcttaaaaaggttgatgttgaagagctgccc
attgcaactcattttattatgagtgaggtttttcctgcctggagtggagaacaattggga
attggcactagcctgctgtatgtttccctttccaaagcctccggaatgccagtaaaaagt
atagaatctcttattcggactaccggagatataggggacacagcccttctgatcctcaag
gagaaaaggaaaaatcaggttactttttcctcttttttcgaagaacagcccgaactctca
ataaccgaagtttataaccgttttaaaattgcctccgaagcctcaggaaaaggttcacag
gacattaagataaagaatcttcagttcctctttacttcctcaactccaagggaagcaaaa
tatatctccaggcttgcgcttgaggaactccgcataggcgtcggagaaggcgttgtaaga
gatgcaattgcaaaagctttttccgtgcctgtggatgtggttgagcacgcctttatggtt
acgaatgacctggggatagtcgctgcaactgccaaggacggcggggtggaagccctagag
agtctcgggattgagatcaaccgcccgatcaagatgatgctctcacagatcagccctgac
atagttgctgacataaaggaaatgaaggaggctgcaatcgaatggaaattcgatggggca
agagtccaggtccataaggctggagattcggttatgcttttttcacgaaagcttgaaaat
gtcacaaattccctccctgaccttgtagagataatccgcaaacatgtaaaggccgaatct
gcaattcttgatggagaagccgtcgcagtggacgaaaatggaaggcccagggcatttcaa
gagatccttaaacgtttccggcgcaagtacgatgtggaagaaaaagcccttggcatccct
attcagctaaacctttttgacataatgtacttaaacggaaaaacgctgatagacctgcct
ctgattgaacggcgaaaagcgcttgagtcctgcgtggaaagctcggttgaggattcaaag
tccatctccgtggacaaacaggtgataaccggagacctcgatcttatagagaagatctat
aaggaggctttagacgccgggcacgaaggagttatggtcaaaaacccgaattcgttttat
tcccctggcaaacgcggcaaaaactggcttaagaaaaagcctcttatggaaacccttgac
cttgtagttgttggagccgaatggggatttggcaggcgtgcaaacctcctgggttcttat
acggttgcctgttatgacccaaaaaccctgcgttttctccaagtcggtaaagtgggtacg
ggcctaaccgacgatcagttaaaggaactcacagagatactttccgggctcatggaaggt
ggagaggcaggcggtatatttgcaatccggccgaaaatagtccttgaaatcgcctttgag
gaaatccagaaaagccccaattatgattcaggctttgcgcttcgttttccacgctttatc
cgcatccgggacgataaagaccccgaagaagccgatacgatacagagaattggaaaggta
tatagccagcagttgaaaaggttgtaa

DBGET integrated database retrieval system