KEGG   Methanosarcina barkeri 227: MSBR2_0627Help
Entry
MSBR2_0627        CDS       T03914                                 

Definition
(GenBank) Superoxide dismutase (Mn/Fe)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mbar  Methanosarcina barkeri 227
Brite
Enzymes [BR:mbar01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MSBR2_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(797430..798041)
Genome map
AA seq 203 aa AA seqDB search
MTKGLYKLPDLKYGYGDLAPYMSEEQLKLHHDKHHQAYVTNANAAIEMMDKARKEGTDFD
YKSTAKALSFNLGGHILHNYFWWEMTPESNASKEAVGELAEVIKDNFGSFDRFKKEFTQV
ASSVEGSGWAALTFCNDTNRLMIMQIEKHNVNVAPDYPILMALDVWEHAYYIDYKNNRGK
FIEGFWNILNWEEIDKYFTKIQK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaggattatacaaattaccggatttgaaatatggatatggcgacctagcacct
tatatgtccgaagagcaactcaagttacatcatgacaagcaccaccaggcttatgttact
aacgcaaatgcagctatagaaatgatggacaaagcaaggaaggaagggactgactttgat
tataagtcaactgcaaaagccctgtctttcaacctgggtggtcatatccttcacaattac
ttctggtgggagatgacccctgagagcaatgcgagcaaagaggccgtgggtgaactggcc
gaggtgatcaaagataacttcggaagttttgacaggtttaaaaaggagtttacccaggtt
gcatcaagcgttgaaggttccggatgggcagccttaaccttctgtaatgatacaaataga
cttatgatcatgcagatcgaaaagcacaatgtaaatgtagctccggattaccctatcctc
atggcgctcgatgtgtgggagcacgcttactatattgattacaagaacaatagaggtaag
ttcatagaaggattctggaatatcctcaactgggaagaaatcgataaatatttcacgaaa
atccagaagtaa

DBGET integrated database retrieval system