KEGG   Methanosarcina barkeri 227: MSBR2_1291Help
Entry
MSBR2_1291        CDS       T03914                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, archaeal
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mbar  Methanosarcina barkeri 227
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mbar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSBR2_1291
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSBR2_1291
   00680 Methane metabolism
    MSBR2_1291
Enzymes [BR:mbar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MSBR2_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1650889..1652469
Genome map
AA seq 526 aa AA seqDB search
MSRKTVFPKVMCTQHPDSASKYIATQEEPGEAIEAAQIFGCDEYMPDYEGKATPYHQNVQ
IVSKFIEETDLIPGKDIFITPRAPSAVHENRFRQLMVMMSIAEANHNALEYSDVQAINEF
VHPMTDSVREIIGAQQHMVDVSELAKKEFGFSMEVPCIIPLMEDAPALLHAKELAENTIL
AWKGHFGTVPEKFRVFLGKSDSALSFGHVASTLSCKYAINGICELNSELDTQTGIIFGAG
TLPFRGHLDLKNAENFFREYRGVGTITLQSALRYSHKKGDAESLVKLAKARLPETPELFS
VEEKEEIINLIGIFGTSYSRVIRQLAPTINRIADLLPQQRDRLMHKGTGGYSRSAPDISG
LVNLCRTDIGKELEASMPSEDLQLPRAIKFTGALYSIGLPPEFIGTGRALEEAREKLGEA
ACENLLTKYFPSLAGDLKFASGYLDLNVASRFLSSECLKEVRKDLDILHEAFDLETSPEP
SYRILVEMMQPDLLQAGSKGNCMDEEVSQLVCSTLTKMGKIRKALG
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaaaaaccgtttttccaaaagtaatgtgtacccagcacccggactcggcgtca
aaatatattgcaacgcaggaagagcctggagaagctatagaggctgcacagatattcggc
tgtgatgagtacatgccggattatgaagggaaggcaactccctaccatcagaatgtccag
attgtatcaaaattcatagaagaaacagacctgatcccaggaaaagatatttttatcact
cctcgagctccgagtgcggttcatgaaaaccggttcagacagctcatggttatgatgtca
attgctgaggctaatcacaatgctcttgaatactcggatgttcaggcaatcaatgagttt
gtgcaccccatgacagacagcgtcagggaaattattggagctcaacagcatatggtagac
gtaagtgagcttgcaaaaaaggaatttggtttctcaatggaagtcccttgcataattccc
cttatggaagatgctcctgcactgctacatgcaaaagaacttgcagaaaatacgattctt
gcctggaaaggacacttcgggacagttcctgagaaattcagggtgtttctgggcaaatcc
gactctgctctttcttttggacacgttgcaagcacgctttcatgcaaatacgcaataaac
ggaatctgcgaactaaattccgaactcgacacccaaactggcattatattcggagcagga
acgctgcctttcagaggacaccttgacctgaagaatgcagagaactttttcagggaatac
aggggagtcgggaccattactctccagtccgcgctcaggtacagccataaaaaaggggac
gctgaatcccttgtaaaacttgcaaaggccaggctacctgaaacgcctgaactcttttcc
gtcgaagaaaaagaagaaataataaacctcattgggatatttgggacaagctacagcagg
gttatcaggcaactggctcctacgataaaccggatagctgaccttcttccacagcagcgg
gatcgtcttatgcacaaaggtacaggtggctattcaagaagcgctcctgatatctcaggc
ctggttaacctctgccgtaccgatataggaaaagagcttgaagccagtatgccttctgaa
gaccttcagcttccaagggcaatcaagtttacaggcgctctttattccataggcctgcct
ccggaattcatagggacaggccgtgctcttgaagaagctcgggaaaaactcggagaagct
gcctgtgaaaacttgcttacaaaatacttcccctcccttgcaggtgacctgaagtttgca
tcaggctatctggatctcaatgtagcttctcgcttcctatcaagtgaatgcctgaaggaa
gtccgcaaagatttagatatcctgcatgaggcctttgatcttgaaaccagtccggaacct
tcataccgcatcctggtagaaatgatgcagcctgacctcctgcaggcaggaagtaaagga
aattgtatggatgaggaagtttcccagcttgtatgctcgaccctcaccaaaatgggaaaa
ataagaaaggccctcggttaa

DBGET integrated database retrieval system