KEGG   Methanosarcina barkeri 227: MSBR2_2288Help
Entry
MSBR2_2288        CDS       T03914                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mbar  Methanosarcina barkeri 227
Pathway
mbar00630  Glyoxylate and dicarboxylate metabolism
mbar01100  Metabolic pathways
mbar01120  Microbial metabolism in diverse environments
mbar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbar00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSBR2_2288
Enzymes [BR:mbar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MSBR2_2288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKB58804
UniProt: A0A0E3R5K0
LinkDB All DBs
Position
complement(2991502..2992788)
Genome map
AA seq 428 aa AA seqDB search
MRRDYIDTGYSPKDTDFICEFHIEPSAGVNFEEAATHMAGESSIDSWTEIATLSPELAAR
LKPHVFYVDEDAQTVRVAYSEELFELYSVPQVLSAVAGNILSMKIVDNLRLQDIAFPKSM
LREFKGPGFGLPGIRKLTGVQDRPLIGTIVKPKVGLTSEKHAEVAYNSFAGGCDLVKDDE
NLTDQKFNKFEKRAELTLKLAEKAESETGERKMYLCNITAPTCKEMIRRMNILKDLGASY
AMIDIVPVGWTALQTLREEAGDAGLALHAHRCMHSAYTRNPRHGISMLVVAKLCRLIGLD
QLHIGTVVGKMHGEKHEVLSLRDECVLDNVPADESQHVLAQDWGGLKPMFPVASGGLAPT
MIPDLYTIFGRDVIMQFGGGIHAHPMGTAAGATACRQALEASLEGVSLQEYAKNHRELEA
AINKWLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagggattatatagacacgggctacagcccaaaagataccgattttatctgtgaa
ttccatatcgaaccgtcagcaggagtgaattttgaagaagctgcaactcatatggcaggg
gaaagctccatagattcctggactgaaattgccacgcttagtcccgaacttgcagccagg
ctaaagccacatgttttttacgtggacgaggacgcacagactgtaagggtagcttattcg
gaagagctctttgaactttattcggtcccgcaggtactcagcgcagttgcaggaaatatc
ttgagtatgaaaattgttgacaatctcagactccaggatatagctttcccgaagtcaatg
cttcgagaattcaaaggtcctggattcgggttgccaggaatcaggaaacttacaggtgtg
caggacaggcctctcataggaactattgtcaagccgaaagttggattaacttccgaaaaa
catgctgaagtggcttacaattcctttgcaggcggttgcgaccttgttaaagatgatgag
aaccttacggatcagaaatttaacaaatttgaaaaaagagctgaacttaccctgaagctt
gcagaaaaggcagaatctgaaaccggagagcgtaaaatgtatctctgtaatatcactgct
cctacctgtaaggaaatgatccgtcgcatgaatatccttaaagacctgggtgccagctat
gcgatgatcgacatcgtacctgtaggttggactgcacttcagaccctgagggaagaagca
ggcgatgcaggattagctctccacgcccaccgatgcatgcattcagcctatacccggaac
ccacgccatgggataagcatgcttgtagttgccaagctctgcaggctgatcgggcttgac
cagcttcacataggtacggttgtcgggaagatgcacggagaaaaacacgaggttctgtct
ctccgtgacgaatgtgttctagataatgtgcctgcagatgaaagccagcacgtccttgcc
caggactggggagggttgaagcccatgttcccagttgcttccggagggcttgcccctact
atgattcctgacctgtacactatcttcggaagggatgttattatgcaattcggtggtggt
attcacgctcatccaatgggtactgcagccggagccactgcttgcaggcaggcactcgaa
gcatctcttgaaggagttagcttgcaggaatatgcgaaaaaccacagagaacttgaagcc
gccatcaataagtggctgaagaaataa

DBGET integrated database retrieval system