KEGG   Melittangium boletus: MEBOL_002390Help
Entry
MEBOL_002390      CDS       T05066                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
Organism
mbd  Melittangium boletus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ATB28941
UniProt: A0A250ICR1
LinkDB All DBs
Position
2908154..2909992
Genome map
AA seq 612 aa AA seqDB search
MSQELPRRQTLPFRLGPGAGRHPSREHAQRSPTRVQLPAVSTLAEIVMHWGQTRPSQPLL
SFVDLEDQLTVLTAGELLRDALRLGSHLRARGVKRGDRVVLSFDTSPEFLECFFACGLVG
ATPCLIELPSSKVSVQTWSERLRVKLRMLGARAILMDPDFADLAHESLKDFTPEPGMEAP
FVATPAEFATPAEPFTPEPPDAEDTAFIQFTSGTTDAPKGVQVSHRALLANCAALGEHSQ
WDSDDLMVSWLPLFHDMGLVASTLASFVHGIPTVLMPPFGFLLKPSRWLWALHCFRATNS
FAPNFAYQLCVKRIKDAELEGLDLGSWKRAYNAAEFIHTDTVHQFTERFAPHGFDDDAWK
PSYGMAEMVVAVTVRRRSDPMHQESISRTALSSRREAVPQPRGPDSLLVVGVGKPIRGIE
LRIVDEEGRDVPERHEGEILLRGTSLFGGYYQNPEATQAVLREGWLHTGDLGYLAHGELF
ICGRSKDLIIKAGENHHPYTMENAAARVSGVRTGCVAAVGVNNPQTGTEDIVVLCETTET
KPELLRQLCKHVEDTVFQGAGVRPNRVLPVPPQTLPKTTSGKLKRAYIREHIEAFDKLSL
LVAPPPKQAVVH
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggagctcccgcgtcgccagacccttcccttccgcctgggccctggagcggga
cgccacccgagccgggaacacgcgcagcgctcgcccacgcgggtgcagctccccgccgtg
tccaccctggcggaaatcgtgatgcactggggccagacgcgcccctcccagcccctgctg
tccttcgtggacctggaggatcagctcaccgtgctcaccgcgggcgagctgctgcgcgac
gccctgcgtctggggtcccacctgcgcgcgcggggcgtcaagcggggagaccgggtggtg
ctctccttcgacaccagccccgagttcctcgagtgtttcttcgcgtgtggactcgtgggc
gccacgccctgcctcatcgagctgccctcctcgaaggtgtccgtgcagacgtggagcgag
cggctgcgcgtgaagctgcggatgctcggcgcgcgcgccatcctcatggatccggacttc
gcggacctggcgcacgagtccctcaaggacttcacccccgagcccggaatggaggccccc
ttcgtggcgaccccggccgagttcgccacgcccgccgagcccttcaccccggagcccccg
gacgcggaagacacggccttcatccagttcacctccggcaccacggacgcgcccaagggc
gtgcaggtgtcccatcgcgccctgctggccaactgcgcggccctgggcgagcacagccag
tgggactcggatgatctgatggtgtcgtggctgccgctcttccacgacatgggcctcgtc
gcgagcacactcgcgtccttcgtgcacggaatccccacggtgctgatgccgccgttcggc
ttcctgctcaagccctcgcgctggctgtgggccctccactgcttccgcgccaccaacagc
ttcgcgcccaacttcgcctaccagctgtgcgtcaagcgcatcaaggacgcggagctggag
ggcctggacctcggctcctggaagcgcgcctacaacgccgcggagttcatccacacggac
accgtgcaccagttcaccgagcgcttcgcgccccacggcttcgatgacgacgcgtggaag
ccgtcctacggcatggcggagatggtggtggcggtgacggtgcgccgccggtcggacccc
atgcaccaggagtccatctcgcgcaccgcgctgtcctcgcggcgcgaggccgtaccccaa
ccccggggtccggactcgctcctcgtggtgggcgtgggcaagcccatccgcggcatcgag
ctgcgcatcgtcgacgaggagggccgggatgtccccgagcgccacgaaggagaaatcctc
ctgcgcggcacgtcgctcttcggcggctactaccagaacccggaggccacccaggccgtg
ctgcgcgagggctggctgcacacgggagacctcggctacctggcccacggcgagctcttc
atctgcgggcgcagcaaggacctcatcatcaaggcgggggagaaccaccacccctacacc
atggagaacgccgcggcgcgcgtgtcgggcgtgcgcacgggctgcgtggccgcagtgggc
gtgaacaacccccagacgggcaccgaggacatcgtcgtcctgtgcgagacgaccgagacg
aagcccgagctgctgcgccagttgtgcaagcacgtggaggacaccgtcttccagggcgcc
ggcgtgcgccccaaccgcgtgctccccgtgccgccccagacgctgcccaagacgaccagc
ggcaagctcaagcgcgcctacatccgcgagcacatcgaggccttcgacaagctgtcgctg
ctggtggctcctccccccaaacaggccgtggtgcactga

DBGET integrated database retrieval system