KEGG   Melittangium boletus: MEBOL_003049Help
Entry
MEBOL_003049      CDS       T05066                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mbd  Melittangium boletus
Pathway
mbd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mbd00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MEBOL_003049
Enzymes [BR:mbd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MEBOL_003049
Transporters [BR:mbd02000]
 Other Transporters
  Pores ion channels [TC:1]
   MEBOL_003049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_N_4 GST_C_3 Tom37 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ATB29594
UniProt: A0A250ICL2
LinkDB All DBs
Position
complement(3655519..3656142)
Genome map
AA seq 207 aa AA seqDB search
MSGEVVFYHNPQSRAQMAHWMLHEVGAPFRVVRIDFEKAEHKSPEFLAINPMGKLPTLVH
DGTVVTETAAIIAYLADAFPQAGLAPPPGDKRRGTYYRWLFFGAGCFEPALLDTMFKRPP
VERKGAIGYGSYEDTIGALKTMLAQGPYILGDQFSAADVYVGSEISWAMSFKAPGLDEPL
FKDYIARITARPAYKRAAIADGRTDLK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagaagtcgttttctatcacaacccccagtcgcgggcgcagatggcccactgg
atgctccacgaggtgggtgcgcccttccgcgtcgtgcgcatcgacttcgagaaggcggag
cacaagagcccggagttcctcgccatcaacccgatgggcaagctgccgacgctcgtccat
gacggcaccgtcgtcaccgagacggccgcgatcatcgcgtacctcgccgatgcgttcccc
caggcgggcctggcgccgccgccgggtgacaagcgccggggcacctattaccgctggctc
ttcttcggagcgggctgtttcgagcccgcgctcctcgacaccatgttcaagcgcccgccc
gtcgagcgcaagggcgccatcggctacggcagctacgaggacacgattggcgcgctcaag
acgatgctcgcccagggaccctacatcctcggggaccagttcagcgcggcggatgtctac
gtcggctccgagatcagctgggccatgtcgttcaaggcgccgggattggatgagcccctc
ttcaaggactacatcgcgcggatcacggcgcgccccgcctacaagcgggcggcgatcgcc
gacggccgcaccgacctgaagtag

DBGET integrated database retrieval system