KEGG   Marssonina brunnea: MBM_08435Help
Entry
MBM_08435         CDS       T03105                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
mbe  Marssonina brunnea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MBM_08435
Enzymes [BR:mbe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MBM_08435
Glycosyltransferases [BR:mbe01003]
 Polysaccharide
  Storage polysaccharide
   MBM_08435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 706 aa AA seqDB search
MRREIDTETKRDIRGHYLFEVATEVANRVGGIYSVIKSKAPVTTAEYGDRYCLIGPLHRQ
SAAVEVEALTPTNPQLAATIAAMESRGIGIVYGRWLIEGAPRVVLIDTKTGYRFLDEWKA
DLWHTAGIPSPPGDDETNEAVVFGYLVAWFLGEFVAHEKDKAVIAHFHEWLAGVALPLCK
KRQIDVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERAATHAC
DVFTTVSHITAFESEHLLKRKPDGVLPNGLNVTKFSAMHEFQNLHQQAKEKIHDFVRGHF
YGHNDFDPENTLYFFTAGRYEYRNKGVDMFIESLTRLNQRLKASGSKMTVVAFIIMPAQT
QSLTVEALKGQAVIKSLRDTVDTIERSVGRRIFERALKWHDGDPMPDDKDLITSQDRILL
RRRLFAMKREGLPPIVTHNMANDGDDPILNQIRRVQLFNQEDDRVKIVFHPEFLNSANPV
LPMDYDEFVRGTHMGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSTDY
GIYIVDRRNKGVDDSVNQLASYMFDFAEKSRRQRINQRNRTERLSDLLDWKRMGMEYVKA
RQLALRRAYPSSFSSEDKDDCIPGIEQKISRPFSVPGSPRDRSGMMTPGDFASLQEGREG
LSTEDYVAWKLPEEEDPDEYPFPLTLRAKKSTSPSSPAESLLTNGN
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgaaatcgataccgaaacaaaacgggacatccggggccactatctcttcgag
gtagccactgaggtcgccaaccgagtgggtggcatttactccgtcatcaagtccaaggcc
cccgtcaccaccgccgagtatggcgaccgatactgcctcattgggcctctccacaggcaa
tctgccgccgttgaggtggaagcccttactccaacgaacccccagctggccgccactatc
gcggctatggaatcgcgaggaatcggcatcgtatacggacgctggttgatcgagggagcc
cccagagtcgttctgatcgatactaagacgggataccgctttctggacgagtggaaggcg
gacttgtggcacacggccgggatcccatctcctccgggcgatgatgagaccaacgaggcg
gtagtctttggctacctggtcgcatggttcttaggagagttcgttgcacacgagaaggat
aaagccgtcattgcacatttccacgagtggttggcaggcgtagctcttcccctctgcaag
aagcgacaaatcgatgtcacgaccatcttcacgacccacgcgacccttctcggtcgatac
ctgtgcgctggctcggttgatttctacaacaacctacaatattttgatgtggatcatgag
gcgggaaagcgtggtatctaccaccgctactgcattgagcgcgccgcgacacatgcctgc
gatgtcttcacgaccgtgtctcacatcacggcgtttgaatccgaacatctcctcaagcgc
aagcccgatggtgtgcttcccaacggtctcaatgtcaccaaattctctgccatgcacgag
ttccagaatttgcatcagcaggccaaggagaagattcacgatttcgtccgcggccacttc
tacgggcacaatgactttgacccggaaaacaccctgtacttcttcacggccggtcgctac
gagtaccgaaacaagggtgtcgacatgttcatagagtcgttgacacgcctgaatcaacga
ctgaaggcctccggctcgaagatgaccgtggtcgcattcattatcatgccggcgcaaacc
caatccctaacggtggaggccttgaaggggcaggcggtgatcaaatcattgcgagacacg
gttgacactattgagcgtagcgtgggaaggcggatctttgagcgcgctctcaagtggcac
gatggcgaccctatgcccgatgacaaggatttgatcaccagccaggaccgcatcctcctc
cgcagacggttgttcgccatgaagagggaggggctgcccccgatcgtaacccacaacatg
gccaatgacggcgacgatccgattctgaaccagattcgccgagtccagctcttcaaccaa
gaagatgaccgggtgaagatcgtgttccaccctgaattcctgaactcggccaatcccgtt
ctgccaatggattacgacgagtttgtccgagggactcatatgggcgtcttcccctcttac
tacgagccgtggggatacaccccggcagagtgcaccgtcatgggtgtccctagtatcacc
acgaacctctcgggattcggatgctacatggaggagctgattgagaactcgacggactac
ggaatctacattgtcgaccgccgcaataagggtgtggatgactcagtcaaccagcttgcg
tcctacatgtttgactttgcggaaaagtctcgtcgtcaacgtatcaaccagcgcaaccga
accgagcgtctgagcgatctgctggactggaagcgaatgggcatggagtacgtgaaagca
agacagctggccctccgcagagcatacccctcctccttcagcagcgaggacaaggacgac
tgcatcccgggtattgagcagaagatctcccggccatttagtgttcctggatcgccgagg
gatagaagtgggatgatgacgccgggtgattttgccagtctgcaggaaggcagagagggt
ctgagcacggaggattatgttgcgtggaagttgcctgaggaggaagaccccgatgagtac
ccattccctctcaccctgagggcgaagaaatccaccagtccttcgagccctgccgagtca
ctcctcacgaatggcaactaa

DBGET integrated database retrieval system