KEGG   Marssonina brunnea: MBM_09392Help
Entry
MBM_09392         CDS       T03105                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mbe  Marssonina brunnea
Pathway
mbe00250  Alanine, aspartate and glutamate metabolism
mbe00410  beta-Alanine metabolism
mbe00430  Taurine and hypotaurine metabolism
mbe00650  Butanoate metabolism
mbe01100  Metabolic pathways
mbe01110  Biosynthesis of secondary metabolites
Module
mbe_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mbe00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MBM_09392
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MBM_09392
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MBM_09392
   00430 Taurine and hypotaurine metabolism
    MBM_09392
Enzymes [BR:mbe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MBM_09392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 18765327
NCBI-ProteinID: XP_007297281
UniProt: K1WUP5
LinkDB All DBs
Position
Unknown
AA seq 511 aa AA seqDB search
MASNGTSLPLRDGLAQKSLNRADEVDDLLNAVQSLIIPFIRSADEDADTKRAGHGLAIPG
GGPRTALVEHHKPQKLASIMNFDLPGDGKGKEGLLATVEQLLQYSVNTWDQGFLDKLYAS
TNAVGVISELLLAVLNTNVHVFQVSPALTVIEKTTARNFANLFGFNGPHAGGISTQGGSA
SNTTSIIIARNNLYPASKTEGNANFKFVLFTSAHGHYSVEKAAQLCGMGTDNVWSVPIDA
QGRMIPSELEKLVERAETEGRTPLYVNATAGTTVLGSYDPFTEISAICKKHNLWLHIDAS
WGGPVIFSSEHKYKMSGSHLADSLAVNPHKMMGVPVTCSFLLGPDLTKFHKANTLPAGYL
FHEDSSSGEVWDMADLTLQCGRRGDSLKLALSWIYYGASGFESQIDDAFSIASYFASKVE
KNADFALVSDNPPPCLQVCFYYAKDGKLPESKEENTRTTSAIVQKLIPRGFMVDYAPGDK
GAFFRVVVNRETRRETVDGLVLAIQEVGGSL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaatggcacctcgctacctttaagagatgggcttgcacagaaatcgcttaat
cgagctgatgaagtggatgatttgttgaatgctgttcaatctctgatcatccctttcatc
agatcagcagacgaagatgctgataccaaacgtgcgggtcatggactcgctattcctggt
ggcggtcctcgcactgctctggtcgagcaccacaagcctcagaagcttgctagtatcatg
aactttgacctccctggagatgggaagggaaaagaaggattgctagctactgttgagcaa
ttgctccagtacagtgtcaatacttgggatcaaggcttcttggacaagctgtatgcaagc
accaatgccgttggtgtcatttctgagctgctgctcgcagtcttgaataccaatgtccac
gtcttccaagtctctccagccctcacggtaatcgagaaaactacagcaagaaacttcgca
aatctcttcggcttcaacgggcctcacgcaggtggtataagcacgcaaggaggcagcgcc
tccaacacaacgtctatcatcatcgcccgcaacaacctctacccagccagcaaaaccgag
ggcaacgccaactttaaattcgtccttttcacttccgctcacggacactactccgtcgaa
aaagcagctcagttgtgtggtatgggcaccgataacgtctggtctgttccaatcgatgct
cagggccgcatgatcccctccgagttggagaaattagttgagagagccgagactgaaggc
agaacgccactctacgtcaacgccacagctggcaccaccgtcctcggatcctacgaccca
ttcacagaaatctcagccatatgcaagaaacacaacctgtggctgcacatcgacgccagc
tggggcggtcctgtcatcttctcctctgaacacaaatacaaaatgtccggctcgcatcta
gccgatagtctagccgtgaacccgcacaagatgatgggagtgcctgtcacatgctcattc
ctactcgggcccgatctgacaaagttccataaagcgaataccctccccgcaggctatctc
ttccacgaagactcctctagcggcgaggtctgggatatggcggatctaacgctgcaatgt
ggacggcgtggcgacagtttgaagcttgcgttgagctggatctactacggggcttctggc
ttcgagtcacagatcgacgacgccttttccatcgcttcgtacttcgctagcaaggttgag
aagaatgcggacttcgcgctagtctcggacaacccgcctccttgtctgcaggtatgtttc
tactatgctaaggatgggaagttgccggagagcaaggaggagaatacgaggacgacgagc
gcgattgtgcagaagctgattccgaggggtttcatggtcgattatgcgcctggagataag
ggtgcattttttagggttgtggtcaacagggaaacaaggcgggagacggtggatggattg
gtgttggcgattcaggaggttggggggagtttgtga

DBGET integrated database retrieval system