KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_3364cHelp
Entry
BCGMEX_3364c      CDS       T01727                                 

Gene name
glpD2_2
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BCGMEX_3364c (glpD2_2)
Enzymes [BR:mbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BCGMEX_3364c (glpD2_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3655621..3657378)
Genome map
AA seq 585 aa AA seqDB search
MSNPIQAPDGGQGWPAAALGPAQRAVAWKRLGTEQFDVVVIGGGVVGSGCALDAATRGLK
VALVEARDLASGTSSRSSKMFHGGLRYLEQLEFGLVREALYERELSLTTLAPHLVKPLPF
LFPLTKRWWERPYIAAGIFLYDRLGGAKSVPAQRHFTRAGALRLSPGLKRSSLIGGIRYY
DTVVDDARHTMTVARTAAHYGAVVRCSTQVVALLREGDRVIGVGVRDSENGAVAEVRGHV
VVNATGVWTDEIQALSKQRGRFQVRASKGVHVVVPRDRIVSDVAMILRTEKSVMFVIPWG
SHWIIGTTDTDWNLDLAHPAATKADIDYILGTVNAVLATPLTHADIDGVYAGLRPLLAGE
SDDTSKLSREHAVAVPAAGLVAIAGGKYTTYRVMAADAIDAAVQFIPARVAPSITEKVSL
LGADGYFALVNQAEHVGALQGLHPYRVRHLLDRYGSLISDVLAMAASDPSLLSPITEAPG
YLKVEAAYAAAAEGALHLEDILARRMRISIEYPHRGVDCAREVAEVVAPVLGWTAADIDR
EVANYMARVEAEVLSQAQPDDVSADMLRASAPEARAEILEPVPLD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacccaatccaggcaccggacggcgggcaggggtggcccgccgcggcgctggga
cctgcacagcgcgcggtcgcctggaagcgactcggaaccgagcaattcgacgtcgtggtg
atcggcggcggagtagtgggctccggatgcgctttggatgctgccacccgtgggctcaag
gtggcgttggtcgaggcgcgggacttggcctccggcacgtcgagccgctcctcgaagatg
ttccacggcgggctgcgctacctcgagcaactggagttcgggctggtgcgtgaggcgctc
tatgaacgtgaactgtcgctgaccacgctggcaccgcatttggtcaagccgctgccgttt
ttgttcccgctgaccaaacgctggtgggagcgtccctacatcgccgcgggtatctttctt
tacgaccggctgggtggcgcgaaatcggttccggcgcaacggcattttactcgcgccggt
gcgctgcgactgagccccggcttgaagcgcagctcgctgatcggtggtatccgttactac
gacaccgtcgtcgacgacgcccggcacaccatgacggtcgcgcgcaccgcggcgcattac
ggcgcggttgtccgctgctccacccaggtagtggccttgttgcgagagggtgaccgggtg
atcggcgtgggcgtccgcgactccgagaacggcgcggttgccgaggttcgcggccacgtc
gtggtcaacgcgaccggggtctggaccgatgagattcaagcgttgtccaaacagcgcggg
cgcttccaggtgcgcgcatccaagggcgtgcatgtggtggtgccgcgggaccggattgtc
agtgacgtcgcgatgatcctgcgcacggagaagtcggtgatgtttgtcattccgtgggga
agtcactggatcatcggaaccaccgataccgactggaacctcgacctggcgcaccccgcg
gccaccaaggccgacatcgactacatcctgggcactgtcaacgccgtgttggcgaccccg
ttgacgcacgccgacattgacggagtgtacgccgggctgcggccgctgcttgccggggaa
agcgacgacacctccaagctgtcccgggaacacgccgtggctgtgccggcggcgggcctg
gtggccatcgccggtggcaagtacaccacctaccgagtaatggcggccgacgcgatcgac
gctgctgtgcagttcatccccgcccgcgttgcgccgtcgatcaccgagaaggtcagcctg
ctgggcgccgacggttactttgcactggtcaatcaggccgaacacgtcggcgcgctgcag
ggcctgcacccgtaccgggtgcgccatctgctggaccgctatggttcgctgatcagcgac
gttctagcgatggcggcctccgatcccagcctgttgagcccgataacggaggcaccgggc
tatttgaaggtggaagccgcttacgccgccgccgccgagggcgccctgcatctcgaggac
atcctggcccgtcggatgcggatttccatcgaatacccgcaccggggcgtcgactgcgcc
cgggaggtggccgaggtggtcgcgcccgtgctcgggtggaccgccgcagacatcgaccgc
gaggtcgcgaactatatggcgcgcgtggaggccgaggtgctctcccaggcccagcccgac
gacgtttcggcggacatgttgcgggccagcgcacccgaggcgcgtgccgagatcctcgag
ccggtgcctttggattga

DBGET integrated database retrieval system