KEGG   Mycobacterium bovis AF2122/97: Mb0036Help
Entry
Mb0036            CDS       T00132                                 

Gene name
fadD34
Definition
(RefSeq) fatty-acid--CoA ligase
Organism
mbo  Mycobacterium bovis AF2122/97
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
UniProt: 
LinkDB All DBs
Position
37243..38931
Genome map
AA seq 562 aa AA seqDB search
MTAALLSPAIAWQQISACTDRTLTITCEDSEVISYQDLIARAAACIPPLRRLDLKRGEPV
LITAHTNLEFLSCFLGLMLHGAVPVPIPPREALKTTERFMTRLGPLLRHHRVLICTPAEH
DEIRAAASTDCQISRFTALAEAGDEQFGRATAQQLADTATADWPLCTLDDDAYVQYTSGS
TAAPRGVVITYRNLLSNMRAMAVGSQFQHGDVMGSWLPLHHDMGLVGSLFAALFNSVSAV
FTTPHRFLYDPLGFLRLLTSSGATHTFMPNFALEWLINAYHRRGADIEGIDLHKMRRLII
ASEPVHAEGMRRFAATFAGVGLAPTALGSGYGLAEATVAVSMSAPNTGFRTETHAAAEVV
TGGRVLPGYEVRIDAAPGARAGTIKLRGDSVAAKAYVGGKKLDALDEEGFCDTHDLGFLV
DDEIVILGRQDEVFIVHGENRFPYDIEFIIRGESEQHRTKVACFGVNERVVVVLESPLDS
IIDKAEADRLRCQVVAATGLQLDELITVRRGAIPTTTSGKLKRRAVAQAYRDGTLPRLAT
HAWTADPDSAPKTTRSSLEGAH
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggccttgctttcaccagccatcgcctggcagcagatctcggcttgcacggac
cgcacgctgacgatcacttgcgaggattccgaggtaatcagctatcaggacctcatcgcg
cgcgcggcggcatgcatccccccgctacggcgtcttgacctcaaacgcggtgaacccgtg
ctgatcaccgcccacaccaacctggaattcctgtcctgctttttgggcctcatgctccat
ggcgctgtgccggtacccatcccgccgcgggaggcactgaagaccaccgagcgtttcatg
actcggctcggcccactgctgcgccatcaccgcgtgctgatctgcacaccggccgaacac
gacgagatacgcgctgccgccagcaccgactgccagatcagcagatttactgccctagcc
gaggctggcgacgagcagttcggccgcgccacggcccagcaactcgccgacaccgccacc
gccgactggccgctatgcaccctcgacgacgacgcctacgtccaatacacctctggcagc
accgcagcaccacgcggagtggtcatcacctaccgcaacctgctgtccaacatgcgcgca
atggccgtgggctcacaattccagcacggcgatgtcatgggcagctggctgcccttgcac
catgacatggggctggtgggcagcctattcgccgcactcttcaacagtgtcagcgcggta
ttcaccacgccacaccggtttctgtatgacccgttgggattcctcagactgctcaccagc
tccggggctacccacacgttcatgcctaacttcgctctggagtggctgatcaacgcctac
cacaggcgcggcgccgacatcgaaggcatcgacctacacaaaatgcgccgcttgatcatc
gcctccgaacccgtccatgccgagggcatgcggagattcgccgccaccttcgccggcgtc
ggacttgcccccacggccctgggttcgggctatggcctggccgaagcgaccgtcgccgtg
tcgatgtcagcgcccaacacgggattccgcaccgaaacccacgccgccgcggaggtcgtc
accggcggccgagtgctgcctggctacgaggtgcgcattgacgccgcaccaggtgcccgg
gccggaacgatcaaactgcgcggcgacagcgtggccgccaaagcctatgtgggcgggaag
aagctggacgcgctcgacgaggaaggcttctgcgacacccacgacttgggttttcttgta
gacgacgaaatcgtcatccttggccggcaggacgaggtgttcattgtccacggagaaaac
agattcccctacgacatcgagttcatcattcgcggggaatccgagcagcaccggaccaaa
gtcgcatgtttcggggtcaacgaacgcgtcgtggttgtgttggaaagcccattggacagc
atcatcgacaaggccgaagccgaccgactgagatgtcaagtcgttgccgcgactgggctg
cagttggatgaactgatcacggttcggcgcggcgcgattcccaccaccaccagcggcaag
ctcaaacgacgcgccgtcgcgcaggcttatcgagacggcacactgccccgtcttgccacc
cacgcgtggacggcggatcccgatagcgctcccaaaacgacccggtccagcctggaaggc
gcccactga

DBGET integrated database retrieval system