KEGG   Mycobacterium bovis AF2122/97: Mb3876Help
Entry
Mb3876            CDS       T00132                                 

Gene name
sodA
Definition
(RefSeq) superoxide dismutase [Fe] SODA
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mbo  Mycobacterium bovis AF2122/97
Brite
Enzymes [BR:mbo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Mb3876 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
UniProt: 
LinkDB All DBs
Position
4256977..4257600
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAIL
LNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTV
QGSGWAALGWDTLGNKLLIFQVYDHQTNFPLGIVPLLLLDMWEHAFYLQYKNVKVDFAKA
FWNVVNWADVQSRYAAATSQTKGLTFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaatacaccttgccagacctggactgggactacggagcactggaaccgcacatc
tcgggtcagatcaacgagcttcaccacagcaagcaccacgccacctacgtaaagggcgcc
aatgacgccgtcgccaaactcgaagaggcgcgcgccaaggaagatcactcagcgatcttg
ctgaacgaaaagaatctagctttcaacctcgccggccacgtcaatcacaccatctggtgg
aagaacctgtcgcctaacggtggtgacaagcccaccggcgaactcgccgcagccatcgcc
gacgcgttcggttcgttcgacaagttccgtgcgcagttccacgcggccgctaccaccgtg
caggggtcgggctgggcggcactgggctgggacacactcggcaacaagctgctgatattc
caggtttacgaccaccagacgaacttcccgctaggcattgttccgctgctgctgctcgac
atgtgggaacacgccttctacctgcagtacaagaacgtcaaagtcgactttgccaaggcg
ttttggaacgtcgtgaactgggccgatgtgcagtcacggtatgcggccgcgacctcgcag
accaaggggttgacattcggctga

DBGET integrated database retrieval system