KEGG   Methylocystis bryophila: B1812_17540Help
Entry
B1812_17540       CDS       T04837                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mbry  Methylocystis bryophila
Pathway
mbry00620  Pyruvate metabolism
mbry00680  Methane metabolism
mbry00710  Carbon fixation in photosynthetic organisms
mbry01100  Metabolic pathways
mbry01120  Microbial metabolism in diverse environments
mbry01200  Carbon metabolism
Module
mbry_M00168  CAM (Crassulacean acid metabolism), dark
mbry_M00346  Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:mbry00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B1812_17540
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    B1812_17540
   00680 Methane metabolism
    B1812_17540
Enzymes [BR:mbry01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B1812_17540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ARN82591
UniProt: A0A1W6MYC7
LinkDB All DBs
Position
3671029..3673767
Genome map
AA seq 912 aa AA seqDB search
MNDAGPASSSAAPSAFATRSVKEASAWLVEQLLLVVERQLPEIAPVLRGFSAGSKLTDYE
MGRTLQAQGILFQLVSIAEQAYAMRRRRHIERERGHDQLLGTFDQVLAGAKRAGVTADEI
RAQLQTLRIRPVITAHPTEAKRVSILEKNRKIYLLLRELESTRWTDRERNALGAQLRDQV
ELLFLTGDLHLEKPTVEHEVAWGLHFFSETIFDLAPEVLATFEQALAKHYPDETFEVTPF
FQFGSWIGGDRDGNPFVTNAVTRQTMRDNALASLNYYRGRTTELGRMLSISPRASHIPQM
LRDELEKRLSALKDASSIRARNQMEPYRQFCNLILYKLNQTLLATRGEPTTDQRYANADE
LIADFKLMEAALAEGRSAALATDLVRPLRRAVEVFRFSTVRLDLRENTTRTTHALADLWR
ATRENDPPQVDSAEWRAWLDEQLQTPPLSIEERERFSSETRDTIEMFELVAELQSKLDRE
AFGSFILSMTHSVADVLGAYVLAKEAGLVKQGSKGVYCSLPIVPLFETIEDLRDAPAIMR
ELLAIPIVKRSAQRQGDLQEVMIGYSDSNKDGGFLPSNWELYKAQARLTAVGLEQGVAIA
FFHGRGGSVSRGGAPTGHAISAQPAGSIRGRFRVTEQGEVVSFKYANRGTAAYQMELLAS
SVFTHALKSEREDALIPRAEFEQAFEDLSSAALRAYTEFVGDANLVLYFQAASPLEEISL
LNIGSRPARRFGAKSLADLRAIPWVFAWAQNRHAITSWFGVGSGLKQFLDERGEPGLELL
RRMHADSRLFRLVLDEVEKALMLVDLEIAGKYASLVEDVAVRESIFAKIAAEHELTRAMV
LKVTGAATVGERFKAYKARLDDRLSTINQVNLEQVELLRRFRSAQDENARELIKIPLLLS
ISCIASGLGATG
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgccggtcccgcatcctcgtccgctgcgccctcggctttcgcgacgcgttcc
gtcaaagaagcctcggcatggctcgtcgagcagcttttgctcgtcgtcgagcggcaactg
ccggagatcgctcccgtgctgcgcggcttctccgcgggctcgaagctcaccgactatgag
atgggccgcaccctgcaggcgcagggcattctgtttcagctcgtctcgatcgccgagcag
gcctatgcgatgcgtcggcgccgccatatcgagcgagagcgtgggcacgatcagctgctc
ggcaccttcgatcaagtgctcgccggggcgaagcgggcgggcgtcacggccgacgagatc
cgggcgcagcttcagaccctgcgcatccggccggtgatcaccgcgcatccgaccgaagcc
aagcgcgtttcgatcctggagaagaaccgcaagatctatctcttgctgcgcgagctcgag
tccacgcgttggaccgaccgtgaacgcaacgcgctcggcgcgcagctgcgcgatcaggtc
gagcttctgtttctgaccggcgatctccacctcgagaagcccacggtcgagcacgaggtc
gcctggggcctgcatttcttctcggagacgatcttcgatcttgctcccgaggtcctcgcg
accttcgagcaggcgctcgccaagcactatcccgatgaaaccttcgaggtgacgcccttc
ttccagttcggctcctggatcggcggcgaccgcgacggcaatcccttcgtcaccaatgcg
gtgacgcgccagaccatgcgcgacaatgcgctggcgagcctgaattattatcgcggccgc
accaccgagcttggccgcatgctttcgatcagcccgcgcgcctcgcatattccgcagatg
ttgcgcgacgagctggagaagcggctgtcggccttgaaggacgcgagctcgatcagagcg
cgcaaccagatggagccctatcgccagttctgcaatctcatcctctataagctcaatcag
accctgctcgcgacgcgtggagagccgacgaccgatcagcgctacgccaacgccgacgag
ctgatcgccgatttcaaattgatggaggcggcgctcgccgagggacgctcggcggcgctc
gcgaccgatctcgtgcggccgctgcgccgggcggtggaagtgttccgcttctcgaccgtg
cggctcgacctgcgcgagaacacgacgcgcacgacccatgcgctcgcggacctgtggcgg
gcgacgcgggaaaacgatccgccgcaggtcgactccgccgaatggcgcgcctggctcgac
gagcagctgcaaaccccgccgctcagcatcgaggagcgcgagcgcttttcctcggagacg
cgcgacacgatcgaaatgttcgagctcgtcgccgagctgcagtcgaagctcgaccgcgaa
gccttcggcagcttcatcctctcgatgacccatagcgtcgcggacgtgctcggcgcctat
gtgctcgccaaggaagcggggctcgtcaagcaaggctccaagggcgtctactgctcgctg
ccgatcgtgccgctgttcgagacgatcgaggatcttcgcgacgcgcccgccatcatgcgc
gagctcctcgccataccgatcgtcaagcgcagcgcccaacgccagggcgatctgcaagag
gtgatgatcggctattccgacagcaacaaggacggcggcttcctgccgtcgaactgggag
ctctacaaggcgcaggcgcggctcacggcggtcggcctggagcagggcgtcgcgatcgcc
ttctttcacggccgtgggggctccgtctcgcgcggcggcgcgccgacggggcacgccatc
tccgctcagccggcgggctcgatccgcgggcgcttccgcgtcaccgaacagggcgaggtc
gtctcgttcaaatacgccaatcgcggcactgcggcctatcagatggagcttctcgcctca
tccgtcttcacccatgcgttgaagtccgagcgcgaggatgctctgatcccccgcgcggaa
ttcgagcaggccttcgaggacctctcgagcgcggcgctgagggcctatacggaattcgtg
ggcgacgccaatctcgtgctttatttccaggcggcctcgccgctcgaggagatctcgctc
ctcaatatcggctcgcgcccagcgcggcgcttcggcgcgaaaagtctggcggatctgcgc
gcgatcccctgggtgttcgcctgggcgcagaaccgccacgcgatcacgagctggtttggc
gtcggctccggcctcaagcagtttctcgatgagcgcggcgagccgggcttggagcttctg
cgccggatgcatgcggattcacgacttttccgcctcgtgctcgacgaggtcgagaaggcg
ctgatgctggtcgatctggagatcgccggcaaatatgcgagccttgtcgaggacgtcgcc
gtccgcgagagcattttcgcgaagattgcggcagagcatgagctcacccgcgccatggtc
ctgaaagtgacgggagcggcgacggtcggcgagcgcttcaaggcctataaagcgcggctc
gatgatcgtttgtcaacgatcaatcaggtcaatctcgagcaggtcgagctgctgcgccgc
ttccgcagcgcgcaggacgaaaacgcgcgggagctgatcaaaattccgctcctgctctcc
atcagttgcatcgcctctggccttggcgccacgggctaa

DBGET integrated database retrieval system