KEGG   Methylococcus capsulatus: MCA1002Help
Entry
MCA1002           CDS       T00205                                 

Definition
(GenBank) glutathione S-transferase domain protein
Organism
mca  Methylococcus capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1048642..1049298)
Genome map
AA seq 218 aa AA seqDB search
MITLYGSAISNYYNKVKLALLEKGIEFREERTIPSQEPAILAKSPLGKIPFIETDRGCLS
ESQAILEYLEDAHPEKPLYPADPYARAKCRELIQHLELNVELIARRLYPEAFFGGEVSEE
TKAEVRPKVEAGLKGVMRLARFRPYVCSEDFGAADCAAWPHLTLIGLATSRVYGEDLVSA
QVPALAEYLAVVAARPAAQKVAADRAEALEAFFGTSKP
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccctgtacggttccgccatcagcaactactacaacaaggtcaagctggccctg
ctcgaaaagggcatcgaattccgcgaggaacggacgattccttcccaggaacctgctatt
ctggcgaagtcgccgctcggaaagatcccgttcatcgaaacggatcggggctgcttgtcg
gaatcccaggccatcctggaatacctggaagacgctcacccggaaaaaccgctctacccc
gccgacccttacgcccgcgccaaatgccgcgaactgatccagcacctcgaactgaacgtc
gaactcatcgcccgcaggctttatccggaagccttcttcgggggcgaggtctccgaggaa
accaaggcggaggtcagaccgaaggtcgaagcgggcctgaaaggcgtgatgcggctggca
cggttcagaccctatgtgtgctccgaagatttcggcgccgccgactgcgccgcctggccg
catttgaccctgatcggcctcgccaccagccgcgtctacggcgaagacctggtctccgcc
caggttccggccctggccgagtatctggcggtggtggcggcccgccccgccgcgcaaaag
gtcgcggcggaccgggccgaggcgttggaagcattcttcggcaccagcaaaccgtaa

DBGET integrated database retrieval system