KEGG   Moraxella catarrhalis 25239: MC25239_01399Help
Entry
MC25239_01399     CDS       T03381                                 

Gene name
mdh
Definition
(GenBank) Malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
mcat  Moraxella catarrhalis 25239
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mcat00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MC25239_01399 (mdh)
   00620 Pyruvate metabolism
    MC25239_01399 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    MC25239_01399 (mdh)
  Energy metabolism
   00680 Methane metabolism
    MC25239_01399 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MC25239_01399 (mdh)
Enzymes [BR:mcat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     MC25239_01399 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1518765..1519751
Genome map
AA seq 328 aa AA seqDB search
MKQPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEIPVEKAQQALQGVIMELD
DCAFPLLVDVIGTDDPKVAFKDADYALLVGARPRGPGMERADLLQENAKIFTVQGKALNE
VASRDVKVLVVGNPANTNAYIAMKSAPDLPAKNFTAMLRLDHNRALTQVAKKTGKAVKDI
KKLIVWGNHSPTMYADYRFATINGESVKEIINDQDWNANTFLPTVGKRGAAIIEARGLSS
AASAANAAIDHMRDWALGSNGEWVTMGIPSDGSYGIPKGIMFGFPVTTENGEYQIVQDLQ
IDDFSQERINITLNELEEERAAIDHLFS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacctgtacgagttgctgtcactggtgctgctggtcaaattggctacagctta
ctattccgtatcgcatcaggtgaaatgctgggtaaggatcagcctgtcattttacaatta
cttgaaattcctgttgaaaaagcacaacaagcactacaaggcgttatcatggaacttgat
gactgtgcttttccattattagttgatgtcattggtaccgatgatcctaaagtagcattt
aaagatgctgattatgcactattggttggtgctcgcccacgcggtcctggcatggagcgt
gctgacctgcttcaagaaaatgcaaaaatctttactgttcaaggtaaggcgcttaatgaa
gttgcaagtcgtgatgttaaagtattagtcgttggtaacccagcaaataccaatgcttat
atcgccatgaaatcagcacccgatttaccagccaaaaatttcaccgccatgctgcgtctt
gaccataaccgtgcgttaacgcaagttgccaaaaaaacaggcaaagctgtcaaagacatc
aaaaaattaatcgtttggggcaaccacagtccaaccatgtacgctgattatcgctttgct
accattaatggcgaatcagtcaaagagataatcaatgatcaagactggaatgctaataca
ttcctgccaaccgttggtaagcgtggtgcagcgattatcgaagcgcgtggcttatcatca
gctgcttctgctgccaatgcagccatcgatcatatgcgtgattgggcattaggctcaaat
ggtgaatgggtaactatgggtattccatctgatggctcgtatggcattcctaaaggtatc
atgttcggcttccctgtgactaccgaaaatggtgaatatcaaatcgtccaagatttgcaa
attgatgacttcagccaagagcgtatcaatatcacactaaacgaacttgaagaagagcgt
gccgctattgatcatttattttcttaa

DBGET integrated database retrieval system