KEGG   Mycobacterium chubuense: Mycch_2433Help
Entry
Mycch_2433        CDS       T02150                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mcb  Mycobacterium chubuense
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mycch_2433
  Energy metabolism
   00680 Methane metabolism
    Mycch_2433
Enzymes [BR:mcb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mycch_2433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2504988..2507810
Genome map
AA seq 940 aa AA seqDB search
MAQTSDLAPIGSVQRTQGGREATEPMREDIRLLGAILGDTVREQNGEETFDLVERARVES
FRVRRSEIDRSELATLFDGIDVGEAIPVIRAFTHFALLANVAEDIHRERRRAIHEAAGEP
PQNSSLAATYLKLDGADLDAATVADALTGALVAPVITAHPTETRRRTVFDTQHRITELMR
LRLHGHTTTDDGRDLERELRRHILTLWQTALIRLSRLKISDEIETGLRYYPAAFFDVIPE
VNAQVRAALQARWPDAGLLEEPILRPGSWIGGDRDGNPNVTADVVRLATGSAAYTAFAHY
LSELTALEQELSMSVRLVHITDALAALADACHEPARADEPYRRALRVVHARLTATARQIL
DRRAEHELDLGMEAYEAPAELLADLDVIDASLRGHGSAVLADDRLGRLREAVRVFGFHLS
GLDMRQNSDVHEEVVAELLAWAGVHTDYMSLSEPERVDLLAAELATRRPLTGPGAVGVPP
ACGGLSELARKELDIVSAAARAVHVFGAQAVPNYIISMCRSVSDMLEAAILLKEAGLLDA
SSETPYAPVGIVPLFETIDDLQRGSATLEAALDLPLYRAVVAARGDSQEVMLGYSDSNKD
GGYLAANWALYRAELDLVESARKTGIRLRLFHGRGGTVGRGGGPSYEAILAQPPGAVRGS
LRITEQGEVIAAKYAEPRIAHRNLETLLAATLEATLLDVEGLGDAAGPAYEVLDDLAERA
QRAYAELVHETPGFVDYFKASTPVSEIGALNIGSRPTSRKPTTSISDLRAIPWVLAWSQS
RVMLPGWYGTGTAFEHWIDDGNDPDARLEVLRDLYRRWPFFATVLSNMAQVLAKSDLGLA
ARYAELVDDEALRRRVFDKIADEHERTIRMYKMITGQDDLLADNPALARSVFNRFPYLEP
LNHLQVELLRRYRSGDEDELVQRGILLTMSGLATALRNSG
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atggctcagacatccgacctcgcacccatcggctccgtacagcggacgcagggagggcgt
gaagccaccgagccgatgcgcgaagacatccgcctgctcggagccatcctcggcgacacg
gtccgcgagcagaacggcgaggagaccttcgacctggtcgagcgtgcccgcgtcgagtcc
ttccgggtgcgccggtccgagatcgaccggtccgagctggccacgctgttcgacgggatc
gacgtcggtgaggccatcccggtgatccgcgcgttcacccacttcgcgctgctggccaac
gtcgccgaggacatccaccgggagcggcgccgggccatccacgaggccgccggcgaacca
ccgcagaacagcagcctggccgcgacctacctgaagctcgacggcgccgacctcgacgcc
gcaaccgtcgccgacgcactcaccggagcgctcgtggcgcccgtcatcaccgcgcatccc
accgagaccaggcggcgcacggtcttcgacacccagcaccggatcaccgagctgatgcgc
ctgcgcctgcacgggcacacgacgaccgacgacggccgcgacctcgagcgggaactgcgc
cgccacatcctcacgctgtggcagaccgcgctgatccggctgtcccggctgaagatctcc
gacgagatcgagaccggcctgcggtactaccccgcggcattcttcgacgtgatcccggag
gtcaacgcccaggtgcgggcggccctgcaggcacgctggcccgatgccggcctgctcgag
gagccgatcctgcggcccggttcgtggatcggtggggaccgggacggcaatcccaacgtc
accgccgacgtggtgcggctggccacgggcagcgcggcgtacaccgcgttcgcgcactac
ctcagcgagctgaccgcgctggaacaggaactgtcgatgtcggtgcgcctggtgcacatc
accgacgccctggccgcgctggccgacgcgtgccacgagccggcgcgtgccgacgagccg
taccgccgcgcgctgcgcgtggtgcacgcgcggctcacggccacggcccggcagatcctc
gaccgccgagccgagcacgagctcgacctcggcatggaggcctacgaggcgccggccgag
ctgctggccgacctcgacgtcatcgacgcctcgctgcgcggccacggcagcgccgtcctg
gccgacgaccggctgggccgcctgcgagaagcggtccgtgtcttcgggtttcacctgtcc
ggactcgacatgcgacagaactccgacgtgcacgaggaggtcgtggccgagcttctcgcc
tgggccggggtgcacaccgactacatgtcgctgtccgagccggaacgggtcgatctgctg
gccgcggagctggccacccggcggccgctgacgggcccgggtgcggtgggcgtcccgccc
gcgtgcgggggactgtcggaactcgcgcgcaaggagctcgacatcgtgtcggcggcggca
cgggccgtgcacgtcttcggcgcgcaggccgtgccgaactacatcatctcgatgtgccgg
tcggtgtcggacatgctcgaggcggcgatcctgctcaaggaggccggcctgctcgacgcc
tcgtcggagactccgtacgcaccggtcggcatcgtgccgttgttcgagaccatcgacgac
ctccagcgaggatccgccactctcgaagcggcacttgaccttccgctctaccgcgcggtc
gtggccgcgcgcggcgacagccaggaggtgatgctcggttactcggactccaacaaggac
ggcggatacctggccgcgaactgggcgctgtaccgggccgagctcgatctcgtcgagtcg
gcccgcaagaccggcatccggttgcgcctgttccacggccgcggcggcaccgtcggccgc
ggcggcggtccgagctacgaggcgatcctggcccagccgcccggcgcggtgcggggctcg
ctgcggatcaccgaacagggagaggtgatcgccgccaagtacgccgagccgcgcatcgcc
caccgcaacctggagaccctgctcgccgcgacgctcgaggcgaccctgctcgacgtcgag
gggctcggcgatgcggccgggccggcctacgaggtgctcgacgacctggccgagcgcgcg
cagcgtgcctacgccgaactggtgcacgagacaccgggattcgtcgactacttcaaggcc
tcgactccggtcagcgagatcggcgcactcaacatcggcagcaggccgacgtcgcgcaag
ccgaccacgtcgatctccgacctgcgggcgatcccgtgggtgctggcgtggagccagtcg
cgggtgatgctgcccggctggtacggcaccggtaccgcgttcgagcattggatcgacgac
ggcaacgacccggacgcgcggctggaggtcctgcgcgacctctaccggcgctggcccttc
ttcgcgaccgtgctgtcgaacatggctcaggtgctggccaagtcggacctcgggctggcc
gcgcgctacgccgaactcgtcgacgacgaggcgctacggcggcgggtcttcgacaagatc
gccgacgagcacgagcgcacgatccgcatgtacaagatgatcaccggccaggacgacctg
ctggccgacaacccggcgctggcccggtcggtgttcaaccggttcccgtacctcgagccg
ctcaatcacctgcaggtcgaactgctgcgccgctaccgctcgggtgacgaggacgaactc
gtgcagcgcggcatcctgctgacgatgagcgggctggccaccgcgctgcgcaacagcggc
tga

DBGET integrated database retrieval system