KEGG   Mycobacterium chubuense: Mycch_3262Help
Entry
Mycch_3262        CDS       T02150                                 

Definition
(GenBank) acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II
Organism
mcb  Mycobacterium chubuense
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3406862..3409642)
Genome map
AA seq 926 aa AA seqDB search
MASDEQATLLLELVRGLTAEVHPHAVRRTVTLDSHFDDLGIGSLELAELLRRAQDAFGVA
LPPHLLANAETPRDLLQAVRRSHAPAGEGRSTVTPLATTVAGSSAPATASTLLDALDWHL
GATPQRIHIRILDESGHPDDITYEALHREAAAVAAGLLDRDVMPGDTVAIMLPTSRAYFV
TFAGVVLAGAVPVPIYPPARPSQLADHLRRHTGILANAGATLLVTVPEAVSLGRLLRSNL
ASLRDVVVPAALMGSATGGALPRPRSDDLALVQYTSGSTGQPKGVALTHDNLLANIRAMG
QATAVSAADTFVSWLPLYHDMGLIGAWLGCLYFAVPLVAMAPQVFLTRPSRWLWAIHENR
GTISAGPNFAYELCLSKIDDAEIVGLDLSSWRLAFNGAEPVSPATIERFTGRFAPYGLRH
NTITPVYGLAESAVGLAFPPLGRGPLIDSVERDTFVRTGRADPADADDRDALRFVACGQP
LPGHEIRVVDATGNELGDRHEGRIEFRGPSATAGYFHNPDATRSLFHDDWLDTGDLGYIA
DADVYVTGRVKDVIIRAGRNLHPTELEEAVGNLTGIRRGCVAVFSSPDPSGGAERLVVMA
ETRGSDDKTAAALRSEIMATTVDLLGVAPDDVVLAPPRTVPKTSSGKIRRAASREIYERG
NIGARPRALWWELARVRLRGTVPSMRRARRAAAALAFAAYAWVVYVVLAALVLLQLPLVP
RLRWRWSIACRTVRLLARLTGTSVSVHGLDQLPQGPAIVVANHPSWLDGLALATVVPPSF
RFVAGEVLEHERLIGFVLERLGAVFVERYEREHGVADSDKVVALVREGRSLVVFPEGHLA
RAPGLRPFHMGAFVAAAQSGVPIVPVAIRGTREMLRPEHHFPRRGSVAIAVGEPIQPLGT
DWTAAVGLQCAARDVILRLSGEPDVE
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgatgagcaggcgactctccttctagaactcgtgcgcgggctcaccgccgaa
gtccacccgcacgcagtgcgacgcaccgtcacgctcgatagtcacttcgacgacctcggt
atcggcagcctcgagctggccgagttgttgcgtcgcgcccaggatgcgttcggcgtcgca
ctaccgccacatttgctggccaacgctgagacgccacgtgacctcctacaggcggtcagg
cgctcccatgcgcccgcgggtgagggccggagcaccgtcacgcctctggccaccacggtg
gcgggcagctcggcaccagcgaccgcatcaaccctgctcgacgccctcgactggcacctg
ggtgcgacgccgcagcgaatacacatccgcatcctcgacgagtcggggcaccccgatgac
atcacatatgaggcgctgcaccgggaggcggcggcggtggcggcggggctgctggatcgc
gacgtcatgcccggcgacaccgtcgccatcatgctgcccaccagccgggcatacttcgtc
accttcgccggcgtcgtcctggccggtgccgtgccggtccccatctacccgccggcccgg
ccgtcccagttggcggatcacctgcgtcgccacaccggcatcctcgccaacgccggtgcg
acactgctggtgacggtgcccgaggccgtctcgctggggcgcctgctgcgctctaacctc
gcgagcctgcgcgacgtcgtcgtccctgcagccctcatgggcagcgcgacgggaggtgcg
cttcctcggccccgctccgacgatctggcgctggtgcagtacacctcgggcagcaccggc
cagcccaaaggcgttgcgctcactcacgacaacctgctggccaacatccgcgcgatgggt
caggccaccgcggtatcggcggcggacacgttcgtcagctggctgccgctgtatcacgac
atggggctgatcggggcgtggctcgggtgcctgtatttcgcggtgccgcttgtcgcgatg
gccccacaggtcttcctgactcggccgtcgcggtggctgtgggcgattcacgaaaaccgg
ggcaccatctcggccggcccgaacttcgcttacgagctttgcctttccaagatcgacgac
gctgagatcgtaggactcgatctgagctcatggcggctggccttcaacggtgccgagccg
gtcagtccggcgacgatcgaacggttcaccggccgattcgccccttacggcctgcggcat
aacacgattacacccgtgtacgggctggccgagtcggcggtcgggttggcctttccgccc
ctgggccgcggcccgctcatagacagcgtcgaacgcgacacgttcgtgcgtactgggcga
gccgaccccgcagacgcagacgaccgggacgcacttcggttcgtcgcctgcggtcaaccc
cttcccggccatgagatccgcgtcgtcgacgccaccgggaacgagttgggcgatcgccac
gagggccgcatcgagttccgcgggccgtcagcgaccgccggctatttccacaacccggac
gcgacccggtcgctgttccacgatgactggctcgacaccggtgacctcggctacatcgcc
gacgcagatgtgtatgtcaccggccgggtcaaggacgtgatcatccgggccggccgcaat
ctgcaccccaccgaactggaagaggccgtcgggaacctcaccggcatccgcaggggctgc
gtcgccgtgttttccagtcccgatcccagcgggggcgccgagcgcctcgtcgtgatggcc
gagacgcggggaagcgatgacaagacggccgctgcgttgcgctccgagatcatggcgacg
acggtggacctactcggagtggcgcccgacgacgtggtccttgcgccaccacgcacggtt
ccgaagacgtcgagcggcaagatccgtcgcgccgcgagccgggagatctacgaacggggc
aacatcggcgcccgaccgcgggcactgtggtgggagctggcccgcgtccggctgcgggga
accgttccgtcgatgcgccgcgcccgccgcgccgcggccgctctcgcgttcgccgcctac
gcatgggtggtgtacgtagtcctcgcggcgttggtactcctccagctgccgctggtgccg
cggttgcggtggcgctggagtattgcctgcaggacggtccgacttctggcccgcctcacc
ggaacgtcggtctctgtgcacggtctcgaccaactgccccagggtcccgcgattgtcgtg
gccaaccatccgagctggctggacggcctcgcgctcgccacggtggtgccgccctccttc
cgtttcgtcgccggcgaagtgctcgagcacgaacggctgatcggtttcgtgctcgagcgg
ctcggcgcggtgttcgtcgagcgctacgagcgtgagcacggcgttgccgactccgacaag
gtggtcgccctggttcgagagggccggtcgctggtcgtcttcccggagggccacctggcg
cgcgcgcccgggctgcggcccttccacatgggcgcgttcgtcgccgccgcccagtccgga
gtgccaatcgtgcccgtcgcgatccgcgggacgcgagaaatgctgcggcccgagcaccac
tttccccgcaggggaagcgtcgccatcgcggtcggtgagccgatccaacccctcgggacg
gactggacggcggccgtcgggctccaatgcgccgcgcgcgacgtcatcctgcggctgtcg
ggtgagccggacgtcgagtga

DBGET integrated database retrieval system