KEGG   Macaca mulatta (rhesus monkey): 100426183Help
Entry
100426183         CDS       T01028                                 

Gene name
POLRMT
Definition
(RefSeq) RNA polymerase mitochondrial
  KO
K10908  
DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     100426183 (POLRMT)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    100426183 (POLRMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
19
AA seq 1228 aa AA seqDB search
MSVLCWGRGAAGLRRALQPCGCPGLLAKEGILGGVCGPRRSSSASPQEQDQDRRKDWGHV
ELLEVLQARVRQLQAESVSEVVVNRVDVARLPERGSGDGGPQPPRKVQRGATGASPVPRS
GWAQRLEKDKRIQRMHMQQLEVNLQMQVQSQSEELKVWPKHLQVEPRLLSKQLAVFLAPE
SSWEEQLPRVLQEAPRKLRLAVGRAPSTQAQLSGQQQKLLAFFKCCLLTDHLPLAHHLLV
THHSQQRKQKLLTLDMYNTVMLGWARQGAFRELVYVLLMVKDAGLTPDLLSYAAILQCMG
RRGRDAGTIERCLKQMSQEGLKLQALFTAVPLSEEEQATVLKAVHKVKPTFSLPPRPPPA
VNTSKLLRAVYAKDGPVSYPKLHLPLKTLQSLFEKQLCVELASKVCVVSVEKPALPSKEV
THARKTLQTLRDHWEKALCRVLQETKNHLEVEVHKGRFSLYPFLCLLDEREVVQMLLQVL
QALPAQGESFTTLARELSARTFSRHVVQRRRLSGQVQALETYYRKYLHLLASDTKVPNPC
LPRQYWEALGAPEALREQPWPLPVQMELGKQLAEMLVQATRMPSSLDNRHGSSRLVPVLY
HVYSFRNVQQIGILKPHPAYVQLLETAAEPTLTFEAVDVPMLCPPLPWTSPHTGAFLLSP
TKLMRTVEGATQHQELLETCPPTALHGALDALTQLGNCAWRVNGRVLDLVLQLFQAKGCP
KLGVPAPASEAPQPAEAHVPQSAAPARKAELRRELARCQKVAREMHSLRAEALYRLSLAQ
HLRGRVFWLPHNMDFRGRTYPCPPHFNHLGSDVARALLEFAQGRPLGPHGLDWLKIHLVN
LTGFKKREPLRKRLAFAEEVMDDILDSADQPMTGRKWWMGAEEPWQTLACCMEVANAVRC
SDPAAYVSHLPVHQDGSCNGLQHYAALGRDSVGAASVNLEPSDVPQDVYSGVAAQVEVFR
RQDAQRGTRVAQMLEGFITRKVVKQTVMTVVYGVTRYGGRLQIEKRLRELTDFPQEFVWE
ASHYLVRQVFKSLQEMFSGTRAIQHWLTESARLISHMGSVVEWVTPLGIPIIQPYRLEHK
VKQVRGGIQSITYTHNGDISQKPNTRKQKNGFPPNFIHSLDSSHMMLTALHCYRKGLTFV
SVHDCYWTHAADVAVMNQVCREQFVRLHSEPILEDLSRFLVSRFCPNPTPRKISQCWEAS
QLKETLQAVPKPGAFDLERVKHSTYFFS
NT seq 3687 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtactttgctggggccgcggcgcggcggggctcagacgggccttgcagccttgc
ggctgcccggggctcctcgccaaagaagggatcctcggtggcgtctgcggccccaggaga
agctcgtccgccagcccccaggagcaagaccaagaccgcaggaaggactggggccacgtg
gagctgctggaggtgctccaggcgcgggtgcggcagctgcaggctgagagcgtgtctgag
gtggtggtgaacagggtggatgtggcgcggctcccagaacgtggcagtggagatggtggc
ccccagccacccaggaaggtccagaggggggccacgggtgccagcccggtgccccgtagc
ggctgggcacagagactggagaaggataagcggatccagcggatgcacatgcagcagttg
gaggtgaacctgcagatgcaagtccagagccagagcgaggagttgaaggtgtggcccaag
cacctgcaggtggagccccggctcctgagcaagcagctggccgttttcctggcccctgag
agctcctgggaggagcagctgccccgggtgctgcaggaggcccctcggaagctgaggctc
gccgtggggcgggccccgtccacgcaggcccagctctcaggtcagcagcagaagctcctg
gccttcttcaagtgctgcctgctcaccgaccacctgccccttgcccaccacttgctggtc
acccaccacagccagcagcggaaacagaagctgctcactctggacatgtacaacaccgtc
atgcttggctgggcgcggcagggggccttcagggagctggtgtatgtgttgttgatggtg
aaggatgctggactcaccccagacctgctgtcctacgcggccatcctccagtgcatgggg
aggcggggccgggacgctgggaccattgaaaggtgtctgaaacagatgagccaggagggg
ctgaagctgcaggcgctcttcaccgccgtgccgctgtccgaggaggagcaggccactgtg
ctgaaggccgtgcacaaggtgaagcccaccttcagcctcccgccgcggccgccgcccgcg
gtcaacacctcgaagctgctcagggccgtgtatgccaaggatgggccggtgtcctacccg
aagctacacttgcccctgaagaccctgcagtcgctttttgagaagcagctttgcgtggag
ctggccagcaaggtgtgcgtggtgtctgtggagaagcctgcattgccaagcaaggaggtc
acgcacgcgcggaagaccctgcagaccctgcgggaccactgggagaaagcgctgtgccgg
gtactgcaggagaccaagaaccacctggaggtggaggtgcacaagggccggttctcactg
taccccttcctgtgcctgctggacgagcgcgaggtggtgcagatgctgctgcaggtcctg
caggcgctgcccgcccagggcgagtccttcaccaccctggcccgggagctgagcgcacgc
actttcagccggcatgtggtgcagaggcggcggctcagtggtcaggtgcaggcgctggag
acgtactacaggaagtacctgcacctgctggcctcggacaccaaggtgcccaacccctgc
ctgccgcggcagtactgggaggcgctgggggcgcccgaggccctgcgggagcagccctgg
cccctgccagtgcagatggagctgggcaagcagctggcggagatgctggtgcaagccacg
cggatgccgtccagtctggacaaccggcacggctcctcccggcttgttcccgtgctctac
cacgtgtactccttccgcaacgtccagcagatcggcatcctgaagccgcacccggcttac
gtgcagctgctggagacggccgcggagcccacgctgaccttcgaggcggtggatgtgccc
atgctgtgtcccccgctgccctggacctcaccgcacacgggcgcctttctgctcagcccc
accaagctgatgcgcacggtggaaggcgccacgcagcaccaggagctgctggaaacctgc
ccgcccaccgcgctgcacggcgctctggacgctctcacccaactgggcaactgcgcctgg
cgcgtcaacgggcgggtgctggacctggtgctgcagctcttccaggccaagggctgcccc
aagctaggcgtgccggccccggcctccgaggctccccagccggcggaggcccacgtgccg
cagagcgccgcgcccgcccgcaaggctgagctgcgccgggagctggcgcgctgccagaag
gtggcccgggagatgcacagcctgcgggcggaggcgctgtaccgcctgtctctggcgcag
cacctgcggggccgcgtcttctggctgccgcacaacatggacttccgcggccgcacctac
ccgtgcccgccgcacttcaaccacctgggcagcgacgtggcgcgggccctgctggagttc
gcccagggccgcccgctcggcccgcacggcctggactggctcaagatccacttggtcaac
ctcaccgggttcaagaagcgcgaaccgctgcggaagcgcctggcctttgcggaggaggtg
atggacgacatcctggattcggcggaccagcccatgacgggccgaaagtggtggatgggc
gctgaggaaccctggcagacgctggcctgctgtatggaggtggcgaacgccgtgcgctgc
tccgaccctgctgcctacgtttcccacctccccgtccaccaggacggctcttgcaacggc
ctacagcattatgctgccctgggccgcgacagcgtgggcgccgcctcggtcaacctggag
ccctcggatgtgccccaggacgtgtacagcggcgtggctgcgcaggtggaggtgttccgc
aggcaggatgcccagcggggcacgcgggtggcacagatgctggaaggctttatcacccgc
aaggtggtgaagcagacggtgatgactgtggtgtacggggtcacccgctacggcggccgt
ctgcagattgagaagcgcctccgggagctgaccgactttccccaggagtttgtgtgggag
gcctcccactacctcgtacgccaggtcttcaagagtctacaggagatgttctcagggacc
cgggccatccagcactggctgaccgagagtgcccgcctcatctcccacatgggctccgtg
gtggagtgggtcacacccctgggtatccccatcatccagccctaccgcctggagcacaag
gtcaagcaagtacgaggtgggattcagagcatcacctacacccacaatggagacatcagc
cagaagcccaacacgcgtaagcagaagaacgggttcccaccgaacttcatccactcgctg
gactcctcgcatatgatgctcactgccctgcactgctacaggaagggcctgaccttcgtc
tctgtgcacgactgttactggacccacgcagctgatgtcgccgtcatgaaccaggtgtgc
cgggagcagtttgtccgcttgcacagtgaacccatcctggaggacctgtcccggttcctg
gtcagccggttctgccctaaccccacaccccggaagatctcccagtgctgggaggccagc
cagctgaaggagaccctgcaggcagtgcccaagccaggggccttcgacctggagcgggtg
aagcattccacctactttttcagctga

DBGET integrated database retrieval system