KEGG   Macaca mulatta (rhesus monkey): 574096Help
Entry
574096            CDS       T01028                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Peroxisome
Longevity regulating pathway - multiple species
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Prion diseases
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    574096 (SOD1)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    574096 (SOD1)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    574096 (SOD1)
   05016 Huntington's disease
    574096 (SOD1)
   05020 Prion diseases
    574096 (SOD1)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     574096 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 154 aa AA seqDB search
MAMKAVCVLKGDSPVQGTINFEQKESNGPVKVWGSITGLTEGLHGFHVHQFGDNTQGCTS
AGPHFNPLSRQHGGPKDEERHVGDLGNVTAGKDGVAKVSFEDSVISLSGDHSIIGRTLVV
HEKADDLGKGGNEESKKTGNAGGRLACGVIGIAQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaaggccgtgtgcgtgttgaagggcgacagcccagtgcagggcaccatcaat
ttcgagcagaaggaaagtaatggaccagtgaaggtgtggggaagcattacaggattgact
gaaggcctgcatggattccatgttcatcagtttggagataatacacaaggctgtaccagt
gcaggtcctcactttaatcctctatccagacaacacggtgggccaaaggatgaagagagg
catgttggagacctgggcaatgtgactgctggcaaagatggtgtggccaaggtgtctttc
gaagattctgtgatctcgctctcaggagaccattccatcattggccgcacattggtggtc
catgaaaaagcagatgacttgggcaaaggtggaaatgaagaaagtaaaaagacaggaaac
gctggaggtcgtctggcttgtggtgtaattgggatcgcccaataa

DBGET integrated database retrieval system