KEGG   Macaca mulatta (rhesus monkey): 710798Help
Entry
710798            CDS       T01028                                 

Gene name
PKM, PKM2
Definition
pyruvate kinase, muscle
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Type II diabetes mellitus
Viral carcinogenesis
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    710798 (PKM)
   01230 Biosynthesis of amino acids
    710798 (PKM)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    710798 (PKM)
   00620 Pyruvate metabolism
    710798 (PKM)
  Nucleotide metabolism
   00230 Purine metabolism
    710798 (PKM)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    710798 (PKM)
   05203 Viral carcinogenesis
    710798 (PKM)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    710798 (PKM)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     710798 (PKM)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   710798 (PKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LinkDB All DBs
Position
13
AA seq 531 aa AA seqDB search
MSKPHSEAGTAVIQTQQLHAAMADTFLEHMCRLDIDSPPATARNTGIICTIGPASRSVET
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATEGFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL
ISLQVKQKGADFLVTEVENGGSSGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
LASFILKAADVHEVRKVLGEKGNDIKIISKIENHEGVRRFDEILEASDGIMVARGDVGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAILDGADCIM
LSGETAKGDYPLETVRMQHLIAREAEAAIYHLQLFEELHRLAPITSDPTEATTVGAVEAS
FKCCSGAIIVPTKSGRSAHQVARYCPRAPIIAGTRNPQTARQAHLYCGIFPVLCKDPVQE
AWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGCRPGSGFTNTMRVVPVP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagccccatagtgaagccgggactgccgtcattcagacccagcagctgcacgca
gccatggctgacacattcctggagcacatgtgccgcctggacattgactcaccacccgcc
acagcccggaacactggcatcatctgtaccattggcccagcttcccgatcagtggagacg
ttgaaggagatgattaagtctggaatgaatgtggctcgtctgaacttctctcatggaact
catgagtaccacgcggagaccatcaagaatgtgcgcacagccacggaaggctttgcttct
gaccccatcctctaccggcccgttgctgtggctctggacactaaaggacctgagatccga
actgggctcatcaagggcagcggcactgcagaggtggagctgaagaagggagccactctc
aaaatcacgctggataacgcctacatggaaaagtgtgacgagaacatcctgtggctggac
tacaagaacatctgcaaagtggtggaagtgggcagcaagatctacgtggatgatggactt
atttctcttcaggtgaagcagaaaggtgctgacttcctggtgacggaggtggaaaatggt
ggctcctcgggcagcaagaagggtgtaaaccttcctggggctgctgtggacttgcctgct
gtgtcggaaaaggacatccaggatctgaagtttggggtcgagcaggatgttgatatggtg
cttgcgtcattcatcctcaaggcagctgatgtccatgaagttaggaaggtcctgggagag
aagggaaacgacatcaagataatcagcaaaatcgagaatcatgagggggttcggaggttt
gatgaaatcctggaggccagtgatgggatcatggtggctcgtggtgatgtaggcattgag
attcctgcggagaaggtcttccttgctcagaagatgatgattgggcggtgcaaccgagct
gggaagcctgtcatctgtgctactcagatgctggagagcatgatcaagaagccccgcccc
acccgggctgaaggcagtgatgtggccaatgcaattctggatggagccgactgcatcatg
ctgtctggagaaacagccaaaggggactatcctctggagactgtgcgcatgcagcacctg
atagcccgtgaagcagaggccgccatctaccacttgcaattatttgaggaactccaccgc
ctggcgcccattaccagcgaccccacagaagccaccaccgtgggtgccgtggaggcctcc
ttcaagtgctgcagtggggccataatcgtccccaccaagtctggcaggtctgctcatcag
gtggccagatactgcccacgtgcccccatcattgctgggacccggaatccccagacagct
cgtcaggcccacctgtactgtggcatcttccctgtgctgtgcaaggacccagtccaggag
gcctgggctgaggacgtggacctccgggtgaactttgccatgaatgttggcaaggcccga
ggcttcttcaagaagggagatgtggtcattgtgctgaccggatgtcgccctggctccggc
ttcaccaacaccatgcgtgttgttcctgtgccgtga

DBGET integrated database retrieval system