KEGG   Macaca mulatta (rhesus monkey): 710798Help
Entry
710798            CDS       T01028                                 

Definition
(RefSeq) pyruvate kinase PKM
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Type II diabetes mellitus
Human papillomavirus infection
Viral carcinogenesis
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    710798
   00620 Pyruvate metabolism
    710798
  Nucleotide metabolism
   00230 Purine metabolism
    710798
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    710798
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    710798
   05203 Viral carcinogenesis
    710798
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    710798
  Infectious diseases
   05165 Human papillomavirus infection
    710798
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     710798
Membrane trafficking [BR:mcc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    710798
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   710798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
12
AA seq 531 aa AA seqDB search
MSKPHSEAGTAVIQTQQLHAAMADTFLEHMCRLDIDSPPATARNTGIICTIGPASRSVET
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATEGFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL
ISLQVKQKGADFLVTEVENGGSSGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
LASFILKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAILDGADCIM
LSGETAKGDYPLETVRMQHLIAREAEAAIYHLQLFEELHRLAPITSDPTEATTVGAVEAS
FKCCSGAIIVPTKSGRSAHQVARYCPRAPIIAGTRNPQTARQAHLYCGIFPVLCKDPVQE
AWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGCRPGSGFTNTMRVVPVP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagccccatagtgaagccgggactgccgtcattcagacccagcagctgcacgca
gccatggctgacacattcctggagcacatgtgccgcctggacattgactcaccacccgcc
acagcccggaacactggcatcatctgtaccattggcccagcttcccgatcagtggagacg
ttgaaggagatgattaagtctggaatgaatgtggctcgtctgaacttctctcatggaact
catgagtaccacgcggagaccatcaagaatgtgcgcacagccacggaaggctttgcttct
gaccccatcctctaccggcccgttgctgtggctctggacactaaaggacctgagatccga
actgggctcatcaagggcagcggcactgcagaggtggagctgaagaagggagccactctc
aaaatcacgctggataacgcctacatggaaaagtgtgacgagaacatcctgtggctggac
tacaagaacatctgcaaagtggtggaagtgggcagcaagatctacgtggatgatggactt
atttctcttcaggtgaagcagaaaggtgctgacttcctggtgacggaggtggaaaatggt
ggctcctcgggcagcaagaagggtgtaaaccttcctggggctgctgtggacttgcctgct
gtgtcggaaaaggacatccaggatctgaagtttggggtcgagcaggatgttgatatggtg
cttgcgtcattcatcctcaaggcagctgatgtccatgaagttaggaaggtcctgggagag
aagggaaagaacatcaagataatcagcaaaatcgagaatcatgagggggttcggaggttt
gatgaaatcctggaggccagtgatgggatcatggtggctcgtggtgatctaggcattgag
attcctgcggagaaggtcttccttgctcagaagatgatgattgggcggtgcaaccgagct
gggaagcctgtcatctgtgctactcagatgctggagagcatgatcaagaagccccgcccc
acccgggctgaaggcagtgatgtggccaatgcaattctggatggagccgactgcatcatg
ctgtctggagaaacagccaaaggggactatcctctggagactgtgcgcatgcagcacctg
atagcccgtgaagcagaggccgccatctaccacttgcaattatttgaggaactccaccgc
ctggcgcccattaccagcgaccccacagaagccaccaccgtgggtgccgtggaggcctcc
ttcaagtgctgcagtggggccataatcgtccccaccaagtctggcaggtctgctcatcag
gtggccagatactgcccacgtgcccccatcattgctgggacccggaatccccagacagct
cgtcaggcccacctgtactgtggcatcttccctgtgctgtgcaaggacccagtccaggag
gcctgggctgaggacgtggacctccgggtgaactttgccatgaatgttggcaaggcccga
ggcttcttcaagaagggagatgtggtcattgtgctgaccggatgtcgccctggctccggc
ttcaccaacaccatgcgtgttgttcctgtgccgtga

DBGET integrated database retrieval system