KEGG   Macaca mulatta (rhesus monkey): 714000Help
Entry
714000            CDS       T01028                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    714000 (CDC23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    714000 (CDC23)
   04114 Oocyte meiosis
    714000 (CDC23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    714000 (CDC23)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    714000 (CDC23)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     714000 (CDC23)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    714000 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
6
AA seq 597 aa AA seqDB search
MAASTSVVPVVVTAAVAPVLSTNSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCDSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTTEVSAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgagtacctccgtagtcccggtggttgtgacggcggcagtggcgcctgtcctg
tccacaaacagcgatttctcagatttgcgggaaattaaaaagcaactgctgcttattgcg
ggccttactcgggagcggggcctactgcacagtagcaaatggtcggcggagttggctttc
tctcttcccgcattgcctctggccgagctgcaaccgcctccgcctattacagaggaggat
gcccaggatatggatgcctataccctggccaaggcctactttgatgttaaagagtatgat
cgggcagcacattttctgcatggctgcgatagcaagaaagcctattttctgtatatgtat
tccagatatctgtctggagaaaaaaagaaggatgatgaaacagttgatagcttaggcccc
ctggaaaaaggacaagtgaaaaatgaggctcttagagaattgagagtggaactcagcaaa
aaacaccaagctcgagaacttgatggatttggactttatctgtatggtgtggtgcttcga
aaactggacttggtgaaagaggccattgatgtgtttgtggaagctactcatgttttgccc
ttgcattggggagcctggttagaactctgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaggccctgcaaaagtatcagaatctcatcgatgtgggcttctct
aagagctcatatattgtttcccaaattgcagttgcctatcacaatatcagagatattgac
aaagccctctccatttttaatgagctaaggaaacaagacccttacaggattgaaaatatg
gacacattctccaaccttctttatgtcaggagcatgaaatcggagttgagttatctggct
cataacctctgtgagattgataagtatcgtgtagaaacatgctgtgtaattggcaattat
tacagtttacgttctcagcatgagaaagcagccttgtatttccagagagccctgaaatta
aatcctcggtatcttggtgcctggacactgatgggacatgagtacatggagatgaagaac
acgtctgctgctatccaggcatatagacatgccattgaggtcaacaagcgggactacaga
gcttggtatggccttgggcagacctatgaaatccttaagatgccattttactgcctttat
tattatagacgggcccaccagcttcgacccaatgattctcgcatgctggttgctttagga
gaatgttacgagaaactcaatcaactagtggaagccaaaaagtgttattggagagcttac
gccgtgggagatgtggagaaaatggctctggtgaaactggcaaagcttcatgaacagttg
actgagtcagaacaggctgcccagtgttacatcaaatatatccaagatatctattcctgt
ggggaaatagtagaacacttagaagaaagcactgcttttcgctatctggcccagtactat
tttaagtgcaaactgtgggatgaagcttcaacttgtgcacaaaagtgttgtgcattcaat
gatacccgggaagaaggtaaggccttactccggcaaatcctacagcttcggaaccaaggc
gagactcctaccaccgaggtgtctgctccctttttcctgcctgcttcactctctgctaac
aacacccccacacgcagagtttctccactcaacttgtcttctgtcacgccatag

DBGET integrated database retrieval system