Macaca mulatta (rhesus monkey): 714001 Help Entry 714001            CDS       T01028                                  Name (RefSeq) histone H2B type 1-K   KO K11252   histone H2B Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05203   Viral carcinogenesis mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     714001  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     714001   09163 Immune disease    05322 Systemic lupus erythematosus     714001   09165 Substance dependence    05034 Alcoholism     714001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     714001   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     714001 Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     714001 Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    714001 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa DUF6246 Motif Other DBs NCBI-GeneID:  714001 NCBI-ProteinID:  XP_001110898 Ensembl:  ENSMMUG00000029761 UniProt:  F6TWY4 LinkDB All DBs Position 6:149378452..149379303 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPATKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGITSKAM GIMNSFLNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggagccagcgaagtccgctcctgcgaccaagaagggctctaagaaggcagtgact aaggcccagaagaaagacggcaagaagcgcaagcgcagccgcaaggagagctactccgtg tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatcacctctaaggccatg ggaatcatgaactccttcctcaacgacatctttgagcgcattgcgggtgaggcttcccgt ctggcgcattacaacaagcgctcgaccatcacttccagggagatccagacggccgtgcgc ctgctgctgccaggggagttggccaagcacgcggtgtcggagggcaccaaggccgtcacc aagtacaccagcgctaagtaa

DBGET integrated database retrieval system