KEGG   Macaca mulatta (rhesus monkey): 714017Help
Entry
714017            CDS       T01028                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    714017 (ABAT)
   00650 Butanoate metabolism
    714017 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    714017 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    714017 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    714017 (ABAT)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    714017 (ABAT)
Enzymes [BR:mcc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     714017 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     714017 (ABAT)
Amino acid related enzymes [BR:mcc01007]
 Aminotransferase (transaminase)
  Class III
   714017 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
20
AA seq 500 aa AA seqDB search
MASMLLARHLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRALMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQ
NASMFVNRPALGILPPENFVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYR
SKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
IGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKVLLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDDSVRNKLILTARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatgttgctcgcccggcacctggcctgcagcttccagcacagctaccgcctg
ctggtgcccggatccagacacattagtcaagccgcagccaaagtcgacgttgaatttgat
tatgatgggcctctgatgaagacagaagtcccagggcctagatctcgggcgttaatgaaa
cagctgaatataattcagaatgcagaggctgtgcattttttctgcaattacgaagagagc
cgaggcaattacctggttgatgtggacggcaaccgaatgctggatctttattcccagatc
tcctctgtccccataggttacagccaccccgccctgctgaaactcatccaacagcctcaa
aatgcgagcatgttcgtcaacagacccgccctcggaatcctgcctccggagaactttgtg
gagaagctccgggagtccttgctttcggtggctcccaaagggatgtcccagctcatcacc
atggcctgcggctcctgctccaatgaaaatgccttcaagaccatcttcatgtggtaccgg
agcaaggaaagagggcagaggggcttctcccaggaggagctggagacgtgcatgattaac
caggcccccggctgccctgactacagcatcctctccttcatgggcgcgttccatgggagg
accatgggttgcttagcgaccacgcactccaaagccattcacaagattgacatcccttcc
tttgactggcccatcgcgccgttcccacggctgaaataccctctggaagagttcgtgaaa
gagaaccaacaggaggaggcccgctgtctggaagaggtggaggatctgattgtgaaatat
cggaaaaagaagaagacggtggccgggatcatcgtggagcccatccagtctgagggtgga
gacaaccatgcgtccgatgacttctttcggaagctgagagacattgccaggaagcatggc
tgcgccttcttggtggatgaggtccagaccggaggtggctgcacaggcaagttctgggcc
catgagcactggggcttggatgacccagcagacgtgatgaccttcagcaagaagatgatg
attgggggcttcttccacaaggaggagttcaggcccaatgctccttaccggatcttcaac
acctggctgggggacccgtccaagaacctactgctggctgaggtcatcaacatcatcaag
cgggaggacctgctaaataacgcagcccatgccgggaaggtcctgctcacgggattgctg
gacctccaggcccggtacccccagttcatcagcagggtgagaggacgaggcaccttttgc
tccttcgatactcccgatgattccgtacggaataagctcattttaactgccagaaacaaa
ggtgtggtgttggggggctgcggtgacaaatctattcgtttccgtcccacgctggtcttc
agggatcaccacgctcacctgttcctcaatattttcagtgacatcttagcagacttcaag
taa

DBGET integrated database retrieval system