KEGG   Macaca mulatta (rhesus monkey): 716671Help
Entry
716671            CDS       T01028                                 

Gene name
PTGS2, PGHS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Arachidonic acid metabolism
Metabolic pathways
NF-kappa B signaling pathway
VEGF signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Retrograde endocannabinoid signaling
Serotonergic synapse
Ovarian steroidogenesis
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Leishmaniasis
Human papillomavirus infection
Kaposi's sarcoma-associated herpesvirus infection
Pathways in cancer
Chemical carcinogenesis
MicroRNAs in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    716671 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    716671 (PTGS2)
   04064 NF-kappa B signaling pathway
    716671 (PTGS2)
   04668 TNF signaling pathway
    716671 (PTGS2)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    716671 (PTGS2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    716671 (PTGS2)
   04913 Ovarian Steroidogenesis
    716671 (PTGS2)
   04921 Oxytocin signaling pathway
    716671 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    716671 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    716671 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    716671 (PTGS2)
   05206 MicroRNAs in cancer
    716671 (PTGS2)
   05204 Chemical carcinogenesis
    716671 (PTGS2)
   05222 Small cell lung cancer
    716671 (PTGS2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    716671 (PTGS2)
   05165 Human papillomavirus infection
    716671 (PTGS2)
   05140 Leishmaniasis
    716671 (PTGS2)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     716671 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 604 aa AA seqDB search
MLARALLLCAVLALGHAANPCCSYPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLLLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDNFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSRLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctgtgcgcagtcctggcactcggccacgcagcaaatcct
tgctgttcctacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccaatat
aagtgcgattgtacccggacaggattctatggtgaaaactgctcaacaccggaatttctg
acaagaataaaattacttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacgttgtgaataacattcccttccttcgaaatgcaattatgagt
tatgtgttgacgtccagatcacatttgattgacagtccaccaacttacaatgctgactat
ggctacaaaagctgggaagccttctctaacctctcctattataccagagcccttcctcct
gtgcctgatgactgcccaactcccttgggtgtgaaaggtaagaagcagcttcctgattca
aatgagattgtggaaaaatttcttctaagaagaaagttcatccctgatccccagggcaca
aacatgatgtttgcattctttgcccagcacttcacgcatcagtttttcaagacagatcat
aagcgagggccagctttcaccaaagggctgggccatggggtggacttaaatcatatttat
ggtgaaactctggatagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagtccctgagcatctgcggtttgctgtggggcaggaggtctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgagaacacaacagagtgtgcgat
gtgcttaaacaggagcatccggaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagattatgtacaacacttgagtggc
tatcacttcaaactgaaatttgacccagaactacttttcaacaaacaattccagtaccaa
aatcgtattgctgctgagtttaacaccctctatcactggcatccccttctgcctgacaac
tttcaaattcatgaccagaaatacaactatcaacagtttatctacaacaactctatatta
ctggaacatggaattacccagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatgttccacccgcagtacaaaaagtatcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tatggtgacatcgatgctgtggagctgtatcctgcccttctggtagaaaagcctcgtcca
gatgccatctttggtgagaccatggtagaagttggagcaccgttctccttgaaaggactt
atgggtaatgttatatgttctcctgcctactggaagccaagcacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttacttcattcagtgttccagatccagagctcatcaaaacagttaccatcaat
gcaagttcttctcgctccagactagatgatatcaatcccacagtactactaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system