KEGG   Macaca mulatta (rhesus monkey): 718225Help
Entry
718225            CDS       T01028                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05034  Alcoholism
mcc05165  Human papillomavirus infection
mcc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    718225 (HDAC7)
  Substance dependence
   05034 Alcoholism
    718225 (HDAC7)
  Infectious diseases
   05165 Human papillomavirus infection
    718225 (HDAC7)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     718225 (HDAC7)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     718225 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 718225
NCBI-ProteinID: XP_015007020
Ensembl: ENSMMUG00000021655
LinkDB All DBs
Position
11
AA seq 1016 aa AA seqDB search
MHSPGADGTQVSPGAHYRSPTGTGYFPRHFRRDTDLFIDSMFVECLSCGCPRPCADTPGP
QPQPMDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPE
LQVGPQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHSNSPGIPYRT
LEPLETEGAARSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPL
LRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQ
ETSLAPFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEP
EAGGTLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRT
RSEPLPPSATAPPPPGPMQPRLEQLKTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGP
GQVVDDGLEHRELSHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQG
GHRPLSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCG
DNSRHPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSR
LKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRE
LKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQ
TFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWTGGLDPPMGDPEYLA
AFRTVVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVV
LALEGGHDLTAICDASEACVAALLGNKVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWG
CMQRLASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atgcacagccccggcgctgatgggacccaggtgagcccgggtgcccactatcgcagcccc
actggcacagggtactttcctcgacattttaggagagacaccgatttattcattgattct
atgtttgtggagtgcctgtcatgtggctgccccaggccctgtgcagacacaccaggccct
cagccccagcccatggacctgcgggtgggccagcggcccccagtggagcccccaccagag
cccacattgctggccctgcagcgtccccagcgcctgcaccaccacctcttcctagcaggc
ctgcagcagcagcgctcggtggagcccatgaggctctccatggacacaccgatgcccgag
ttgcaggtgggaccccaggaacaagagttgcggcagcttctccacaaggacaagagcaag
cgaagtgctgtagccagcagcgtggtcaagcagaagctggcagaggtgattctgaaaaaa
cagcaggcagccctagagagaacagtccattccaacagccccggcattccctacagaacc
ctggagcccctggagacggaaggagccgcccgctccatgctcagcagctttttgcctcct
gttcccagcctgcccagtgaccccccagagcacttccctctgcgcaagacagtctctgag
cccaacctgaagctgcgctataagcccaagaagtccctggagcggaggaagaatccactg
ctccgaaaggaaagtgcgccccccagcctccggcggcggcctgcagagaccctcggagac
tcctccccaagtagtagcagcacgcctgcgtcagggtgcagctcccccaatgacagcgag
cacggccccaatcccatcctgggctcggaggcgctcttgggccagcggctgcggctgcag
gagacttctctggccccgttcgccttgccgacagtgtccttgctgcccgcaatcacgctg
gggctgcccgcccctgccagggctgacagtgaccgcaggacccatccgactctgggccct
cgggggccgatcctggggagcccccacactcccctcttcctgccccatggcctggagccc
gaggctgggggcactttgccctctcgcctgcagcccattctcctcctggacccctcaggc
tctcatgccccgctgctgactgtgcccgggcttgggcccttgcccttccactttgcccag
tccttaatgaccaccgagcggctctccgggtcaggtctccactggccactgagccggact
cgctcagagcccctgccccccagtgccaccgctcccccaccgccgggccccatgcagccc
cgcctggagcaactcaaaactcacgtccaggtgatcaagaggtcagccaaaccgagtgag
aagccccggctgcggcagataccttcggctgaagacctggagacagatggtgggggaccg
ggccaggtggtagacgatggcctggaacacagggagctgagccatgggcagcctgaggcc
agaggccctgctcctctccagcagcacccccaggtgttgctctgggaacagcagcgactg
gctgggcggctcccccggggcagcaccggggacactgtgctgcttcctctggctcagggt
gggcaccggcctctgtcccgggctcagtcttccccagccgcacctgcctcactgtcagcc
ccagaacctgccagccaggcgcgagtcctctccagctcagagacccctgccaggaccctg
cccttcaccacagggctgatctatgactcggtcatgctgaagcaccagtgctcctgtggt
gacaacagcaggcacccagagcacgccggccgcatccagagcatctggtcccggctgcag
gagcggggtctccggagccagtgtgagtgtctccgaggccggaaggcctccctggaggag
ctgcagtcggtccactctgagcggcacgtgctcctctatggcaccaacccgctcagccgc
ctcaaactggacaacgggaagctggcagggctcctggcacagcggatgtttgtgatgctg
ccctgtggtggggttggggtggacactgacaccatctggaatgagctgcattcctccaat
gcagcccgctgggccgctggcagtgtcactgacctcgccttcaaagtggcttctcgtgag
ctgaagaatggtttcgctgtggtgcggcccccaggacaccatgcagatcattcaacagcc
atgggcttctgcttcttcaactcagtggccatcgcctgccggcagctgcaacagcagagc
aaggctagcaagatcctcattgtagactgggacgtgcaccatggcaacggcacccagcaa
accttctaccaagaccccagtgtgctctacatctccctgcatcgccatgacgatggcaac
ttcttcccggggagtggggctgtggatgaggtaggggctggcagcggtgagggcttcaat
gtcaatgtggcctggactggaggtctggatccccccatgggggatcctgagtacctggct
gctttcaggacagtcgtgatgcccattgcccgagagttctctccagacctagtcctggtg
tctgctggatttgatgctgctgagggtcacccggccccactgggtggctaccatgtttct
gccaaatgttttgggtacatgacgcagcaactgatgaacctggcaggaggtgcagtggtg
ctggccttggagggtggccatgacctcacagccatctgtgacgcctctgaggcctgtgtg
gctgctcttctgggtaacaaggtggatcccctttcagaagaaggctggaaacagaaaccc
aacctcaatgccatccgctctctggaggccgtgatccgggtgcacagtaaatactggggc
tgcatgcagcgcctggcctcctgtccagactcctgggtgcctagagtgccaggggctgac
aaagaagaagtggaggcagtgaccgcactggcatccctctctgtgggcatcctggctgaa
gacaggccctcggagcagctggtggaggaggaagaacctatgaatctctaa

DBGET integrated database retrieval system