KEGG   Mycobacterium canettii CIPT 140010059: MCAN_00341Help
Entry
MCAN_00341        CDS       T01585                                 

Gene name
fadD34
Definition
(GenBank) putative fatty-acid-CoA ligase FADD34 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase)
Organism
mce  Mycobacterium canettii CIPT 140010059
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
37192..38880
Genome map
AA seq 562 aa AA seqDB search
MTAALLSPAIAWQQISACTDRTLTITCEHSEVISYQDLIARAAACIPPLRRLDLKRGEPV
LITAHTNLEFLSCFLGLMLHGAVPVPIPPREALKTTERFMTRLGPLLRHHRVLICTPAEH
DEIRAAASTDCQISRFTALAEAGDEQFGRATAQQLADTATADWPLCTLDDDAYVQYTSGS
TAAPRGVVITYRNLLSNMRAMAVGSQFQHGDVMGSWLPLHHDMGLVGSLFAALFNSVSAV
FTTPHRFLYDPLGFLRLLTSSGATHTFMPNFALEWLINAYHRRGADIEGIDLHKMRRLII
ASEPVHAEGMRRFAATFAGVGLAPTALGSGYGLAEATVAVSMSAPNTGFRTETHAAAEVV
TGGRVLPGYEVRIDAAPGARAGTIKLRGDSVAAKAYVGGKKLDALDEEGFCDTHDLGFLV
DDEIVILGRQDEVFIVYGENRFPYDIEFIIRRESEQHRTKVACFGVNERVVVVLESQLDS
IIDEAEADRLRCQVVAATGLQLDELITVRRGAIPTTTSGKLKRRAVAQAYRDGTLPRLAT
HAWTADPDSAPKTTRSSLEGAH
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggccttgctttcaccagccatcgcctggcagcagatctcggcttgcacggac
cgcacgctgacgatcacttgcgagcattccgaggtaatcagctatcaggacctcatcgcg
cgcgcggcggcatgcatccccccgctacggcgtcttgacctcaaacgcggtgaacccgtg
ctgatcaccgcccacaccaacctggaattcctgtcctgctttttgggcctcatgctccat
ggcgctgtgccggtacccatcccgccgcgggaggcactgaagaccaccgagcgtttcatg
actcggctcggcccactgctgcgccatcaccgcgtgctgatctgcacaccggccgaacac
gacgagatacgcgctgccgccagcaccgactgccagatcagcagatttactgccctagcc
gaggctggcgacgagcagttcggccgcgccacggcccagcaactcgccgacaccgccacc
gccgactggccgctatgcaccctcgacgacgacgcctacgtccaatacacctctggcagc
accgcagcaccacgcggagtggtcatcacctaccgcaacctgctgtccaacatgcgcgca
atggccgtgggctcacaattccagcacggcgatgtcatgggcagctggctgcccttgcac
catgacatggggctggtgggcagcctattcgccgcactcttcaacagtgtcagcgcggta
ttcaccacgccacaccggtttctgtatgacccgttgggattcctcagactgctcaccagc
tccggggctacccacacgttcatgcctaacttcgctctggagtggctgatcaacgcctac
cacaggcgcggcgccgacatcgaaggcatcgacctacacaaaatgcgccgcttgatcatc
gcctccgaacccgtccatgccgagggcatgcggagattcgccgccaccttcgccggcgtc
ggacttgcccccacggccctgggttcgggctatggcctggccgaagcgaccgtcgccgtg
tcgatgtcagcgcccaacacgggattccgcaccgaaacccacgccgccgcggaggtcgtc
accggcggccgagtgctgcctggctacgaggtgcgcattgacgccgcaccaggtgcccgg
gccggaacgatcaaactgcgcggcgacagcgtggccgccaaagcctatgtgggcgggaag
aagctggacgcgctcgacgaggaaggcttctgcgacacccacgacttgggttttcttgta
gacgacgaaatcgtcatccttggccggcaggacgaggtgttcattgtttacggagaaaac
agattcccctacgacatcgagttcatcattcgcagggaatccgagcagcaccggaccaaa
gtcgcatgtttcggggtcaacgaacgcgtcgtggttgtgttggaaagccaattggacagc
atcatcgacgaggccgaagccgaccgactgagatgtcaagtcgttgccgcgactgggctg
cagttggatgaactgatcacggttcggcgcggcgcgattcccaccaccaccagcggcaag
ctcaaacgacgcgccgtcgcgcaggcttatcgagacggcacactgccccgtcttgccacc
cacgcgtggacggcggatcccgatagcgctcccaaaacgacccggtccagcctggaaggc
gcccactga

DBGET integrated database retrieval system