KEGG   Mycobacterium canettii CIPT 140010059: MCAN_01291Help
Entry
MCAN_01291        CDS       T01585                                 

Gene name
treS
Definition
(GenBank) trehalose synthase TRES
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00500  Starch and sucrose metabolism
mce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MCAN_01291 (treS)
Enzymes [BR:mce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MCAN_01291 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     MCAN_01291 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: CCC42470
UniProt: G0TME0
LinkDB All DBs
Position
156069..157874
Genome map
AA seq 601 aa AA seqDB search
MNEAEHSVEHPPVQGSHVEGGVVEHPDAKDFGSAAALPADPTWFKHAVFYEVLVRAFFDA
SADGSGDLRGLIDRLDYLQWLGIDCIWLPPFYDSPLRDGGYDIRDFYKVLPEFGTVDDFV
ALVDAAHRRGIRIITDLVMNHTSESHPWFQESRRDPDGPYGDYYVWSDTSERYTDARIIF
VDTEESNWSFDPVRRQFYWHRFFSHQPDLNYDNPAVQEAMIDVIRFWLGLGIDGFRLDAV
PYLFEREGTNCENLPETHAFLKRVRKVVDDEFPGRVLLAEANQWPGDVVEYFGDPNTGGD
ECHMAFHFPLMPRIFMAVRRESRFPISEIIAQTPPIPDMAQWGIFLRNHDELTLEMVTDE
ERDYMYAEYAKDPRMKANVGIRRRLAPLLDNDRNQIELFTALLLSLPGSPVLYYGDEIGM
GDVIWLGDRDGVRIPMQWTPDRNAGFSTANPGRLYLPPSQDPVYGYQAVNVEAQRDTSTS
LLNFTRTMLAVRRRHPAFAVGAFQELGGSNPSVLAYVRQVAGDDGDTVLCVNNLSRFPQP
IELDLQQWTNYTPVELTGHVEFPRIGQVPYLLTLPGHGFYWFQLTTHEVGAPPTCGGERR
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggcagaacacagcgtcgagcaccctcccgtgcagggcagtcacgtcgaaggc
ggtgtggtcgagcatccggatgccaaggacttcggcagcgccgccgccctgcccgccgat
ccgacctggtttaagcacgccgtcttctacgaggtgctggtccgggcgttcttcgacgcc
agcgcggacggttccggcgatctgcgtggactcatcgatcgcctcgactacctgcagtgg
cttggcatcgactgcatctggttgccgccgttctacgactcgccgctgcgcgacggcggt
tacgacattcgcgatttctacaaggtgctgcccgaattcggcaccgtcgacgatttcgtc
gccctggtcgacgccgctcaccggcgaggtatccgcatcatcaccgacctggtgatgaat
cacacctcggagtcgcacccctggtttcaggagtcccgccgcgacccagacggaccgtac
ggtgactattacgtgtggagcgacaccagcgagcgctacaccgacgcccggatcatcttc
gtcgacaccgaagagtcgaactggtcattcgatcctgtccgccgacagttctactggcac
cgattcttctcccaccaaccggatctgaactacgacaaccccgccgtgcaagaggcgatg
atcgacgtcatccgcttttggctcggcttgggcatcgacgggtttcggttggacgcggtg
ccctatctctttgaacgtgagggcaccaactgcgagaacctgccggaaacacacgctttt
ctcaagcgagtccgcaaggtggtggacgacgaattccccggccgggtgctgctagccgaa
gccaatcagtggccgggcgatgtcgtggaatatttcggtgatcccaacaccggtggcgac
gagtgccacatggcctttcacttcccgctgatgccgcgcatcttcatggccgtgcgccgg
gagtcccgttttccgatctcggagatcatcgcccagaccccaccgatccctgacatggcg
caatgggggatatttctgcgcaatcacgacgagctgaccctagaaatggtcaccgacgaa
gagcgcgactacatgtacgccgagtacgccaaggatccacggatgaaggcgaatgtcgga
atccgtcgtcggcttgcgccgctgctcgacaacgaccgcaaccagatcgagctgttcacc
gcgctgctgctgtcgctgcccggctcgccggtcctctactacggcgacgagattgggatg
ggcgacgtgatctggttgggtgatcgcgacggggtgcgcatcccgatgcagtggacaccg
gaccgcaacgcggggttctccaccgccaacccgggtcggctgtacctgccgcccagccag
gacccggtttacgggtatcaggccgtcaacgtcgaggcgcaacgcgacacctcgacgtcg
ctgctcaacttcactcgcaccatgctggccgtgcgtcgccgacaccccgcgtttgcggtc
ggcgcattccaggaattgggcgggtccaacccgtcggtgctggcctacgtgcgtcaggtg
gccggcgatgacggcgacaccgtgctctgtgtcaacaacctgtcgcgattcccgcagccc
atcgaattggacttgcagcaatggaccaactacacgccggtcgagctgaccgggcacgtg
gagtttccacgcatcggccaggtgccctatctgctgacgctgccaggacacgggttctac
tggttccagttgaccacacatgaggtgggggcacctcccacttgcgggggagagcggcgc
ctatga

DBGET integrated database retrieval system