KEGG   Macaca fascicularis (crab-eating macaque): 101926502Help
Entry
101926502         CDS       T02918                                 

Gene name
DOT1L
Definition
(RefSeq) DOT1 like histone lysine methyltransferase
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00310  Lysine degradation
mcf05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101926502 (DOT1L)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    101926502 (DOT1L)
Enzymes [BR:mcf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101926502 (DOT1L)
Chromosome [BR:mcf03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101926502 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1
Motif
Other DBs
NCBI-GeneID: 101926502
NCBI-ProteinID: XP_005587510
LinkDB All DBs
Position
19
AA seq 1732 aa AA seqDB search
MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGP
EGKLAGPTDAPMDSGAEEEKAGAATVKKPSPSKARKKKLNKKGRKMAGRKRGRPKKMSTA
NPERKPKKNQTALDVLHAQTVSQTAASSPQDAYRSPHSPFYQLPPSVQRHSPNPLLVAPT
PPALQKLLESFKIQYLQFLAYTKTPQYKASLQELLGQEKEKNTQLLGAAQQLLSHCQAQK
EEIRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEQDNRALRSQSLQLL
KARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLK
SCVPPDDALSLHLRGKGALGRELEPDAGRLHLELDCAKFSLPHLSSMSPELSMNGQAAGY
ELCSALSRPSSKQNTPQYLASPLDQEVVPCTPSHGGRPRLEKLSGLAAPDYTRLSPAKIV
LRRHLSQDHTVPGRPAASELHPRAEHTKENGLPYQSPSVPGSMKLSPQDPRPLSPGALQL
AGEKSSEKGLRERAYGSSGELITSLPISIPLSTVQPNKLPVSIPLASVVLPSRAERARST
PSPVLQPRDPSSTLEKQIGANAHGAGSRSLALAPAGFSYAGSVAISGALAGSPASLTPGA
EPATLDESSSSGSLFATVGSRSSTPQHPLLLAQPRNSLPASPAHQLSSSPRLGGAAQGPL
PEASKGDLPSDSGFSDPESEAKRRIVFTIAAGAGSARQSPSSKHSPLTASSRGDCVPSHG
QDSRKRGRRKRASTGTPSLSAGVSPKRRALPSVAGLFTQPSGSPLNLNSMVSNINQPLEI
TAISSPETSLKSSPVPYQDHDQPPVLKKERPLSQTNGAHYSPLTSDEEPGSEDEPSSARI
ERKIATISLESKSPPKTLENGGGLAGRKPTPASEPVNNSKWKSTFSPISDIGLAKSADSP
LQASSALSQNSLFTFRPALEEPPADAKLATHPRKGFPGSLSGADGLSPSTNPANGCTFGG
GLAADLSLHSFSDGASLPHKGPEAAGLSSPLSFPSQRGKEASDANPFLSKRQLDGLAGLK
GEGSRSKEAGEGGLQLCGPTDKTPLLTGKAAKARDRELDLKNGHNLFISAAAVPPGSLLS
GPGLAPVASSTGGAASSTQTHRPFLGPFPPGPQFALGPMSLQANLGSVAGSSVLQSLFSS
VPAAAGLVHVSSAATRLTNSHAMGSFSGVAGSTVGGVFNHAVPSASAHPFGARVGRGAAC
GSATLGPSPLQAAASSFQAPASVETRPPPPPPPPPLPPPAHLGRPPAGPPVLHAPPPPNA
ALPPPPTLLASNPEPALLQSLASLPPNQAFLPPTSAASLPPANASLSIKLTSLPHKGARP
SFTVHHQPLPRLALAQAAPGIPQASATGPSAVWVSLGMPPPYAAHLSGVKPR
NT seq 5199 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaagctggagctgagactcaagtcgcccgtgggggctgagcccgccgtctac
ccgtggccgttgccggtctacgacaaacatcacgatgctgctcatgaaatcatcgagacc
atccgatgggtctgtgaagaaatcccggatctcaagctcgctatggagaattacgtttta
attgactatgacaccaaaagcttcgagagcatgcagaggctctgcgacaagtacaaccgc
gccatcgatagcatccaccagctgtggaagggcaccacgcagcccatgaagctgaacacg
cggccgtccactgggctcctgcgccacatcctgcagcaggtctacaaccactcagtgact
gaccccgagaagctcaacaactacgagcccttctcccctgaggtgtacggggagacctcc
ttcgacctggtggcccagatgatcgacgagatcaagatgaccgacgacgacctgtttgtg
gacttggggagcggtgtgggccaggttgtgctccaggtcgccgctgccaccaactgcaaa
catcactatggcgtcgagaaagcggacatcccggccaagtatgcggagaccatggaccgc
gagttcaggaagtggatgaaatggtatggaaaaaagcatgcagaatacacattggagaga
ggcgatttcctctcagaagagtggagggagcgaatcgccaacacgagtgttatatttgtg
aataattttgcctttggtcctgaggtggatcaccagctgaaggagcggtttgcaaacatg
aaggaaggtggcagaatcgtgtcctcgaaaccctttgcacctctgaacttcagaataaac
agtagaaacttgagtgacatcggcaccatcatgcgcgtggtggagctgtcgcccctgaag
ggctcggtgtcatggacgggaaagccagtctcctactacctgcacactatcgaccgcacc
atacttgaaaactatttttctagtctgaaaaacccaaaactcagggaggaacaggaggca
gcccggcgccgccagcagcgcgagagcaagagcaacgcggccacgcccaccaagggcccc
gagggcaagctggccggccccaccgacgcccccatggactctggtgctgaggaagagaag
gcaggagcagccaccgtgaagaagccatctccctccaaagcccgcaagaagaagctcaac
aagaaggggaggaagatggctggccgcaagcgcgggcgccccaagaagatgagcactgcg
aaccccgagcggaagcccaagaagaaccaaactgcactggatgtcctgcacgctcagacc
gtgtctcagacggcagcctcctcgccccaggatgcctacaggtcccctcacagcccgttc
taccagctacctccgagcgtgcagcgtcactcccccaacccgctgctggtggcgcccacc
ccgcccgcgttgcagaagctgctagagtctttcaagatccagtacctgcagttcctggca
tacacaaagaccccccagtacaaggccagcctacaggagctgctgggccaggagaaggag
aagaacacccagctcctgggcgcggctcagcagctcctcagccactgccaggcccagaag
gaggagatcaggaggctgttccagcaaaaattggatgagctgggcgtgaaggcgctgacc
tacaacgacctgattcaggcacagaaggagatctccgcccacaaccagcagctgcgggag
cagtcggagcagctggagcaggacaaccgtgcgctgcgtagccagagcttgcagctgctc
aaggctcgctgcgaggagctgcagctggactgggccacgctgtccctggagaagctgctg
aaggagaagcaggccctgaagagccagatctcagagaagcagaggcactgcctggagctg
cagatcagcatcgtggagctggagaagagccagcggcagcaggagctcctgcagctcaag
tcctgtgtgccgcctgatgacgccctgtctctgcacctacgcgggaagggtgccctgggc
cgcgagctggagcctgacgccggccggctgcacctggagctggactgcgccaagttctcg
ctgcctcacttgagcagcatgagcccggagctctccatgaacggccaggctgccggctat
gagctctgcagcgcgctgagccggccctcgtccaagcagaacacgccccagtacctggcc
tcacccctcgaccaggaggtggtgccctgcacccccagccacggcggccggccgcgcctg
gagaagctgtctggcctggctgcacctgactacacccggctgtccccggccaagattgtg
ctgaggcggcacctgagccaggaccacacggtgcccggcaggccggccgccagtgagctg
cacccgagagctgagcacaccaaggagaacggccttccctaccagagccccagcgtgccc
ggcagcatgaagctgagtccccaggacccgcggcccctgtcacctggggccttgcagctt
gctggagagaagagcagtgagaagggcctgagagagcgcgcctacggcagcagcggggaa
ctcatcaccagcctgcccatcagcatcccgctcagcaccgtgcagcccaacaagctcccg
gtcagcatccccctggccagcgtggtgctgcccagccgcgctgagagggcgaggagcacc
cccagtcctgtgctgcagccccgcgacccctcgtccacacttgaaaagcagattggtgct
aatgcccacggcgctgggagcagaagccttgccctggcccccgcaggcttctcctatgct
ggctcggtggccatcagcggggccttggcgggcagcccggcctccctcacacctggagcc
gagccggccaccttggatgagtcctccagctctgggagcctttttgccaccgtggggtcc
cgcagctccacaccacagcaccccctgctgctggcacagccccggaactcgctcccggcc
tctcccgcccaccagctctcctccagcccccggcttggtggggctgcccagggcccgctc
cccgaggccagcaagggggacttgccctcagactccggtttctcagatcctgagagtgag
gccaagaggaggatcgtgttcaccatcgccgcgggcgcgggcagtgccagacagtcgccc
tccagcaagcacagccccctgaccgccagctcccgtggggactgcgtgccgagccacggg
caggacagccgcaagcgtgggcggcggaagcgagcatcgacggggacgcccagcttgagc
gcaggcgtgtcccccaagcgccgagccctgccgtccgtcgctggccttttcacacaacct
tcggggtctcccctcaacctcaactccatggtcagtaacatcaaccagcccctggagatt
acggccatctcgtcccccgagacctccctgaagagctcccctgtgccctaccaggaccac
gaccagccccccgtgctcaagaaggagcggcctctgagccagaccaatggggcacactac
tccccgctcacctcggacgaggagccaggctctgaggatgagcccagcagcgcccgaatt
gagagaaaaattgcaacaatctccttagaaagcaaatctcccccgaaaaccttggaaaat
ggtggtggcttggcgggaaggaagcccacgcccgcgagcgagccagtcaacaacagcaag
tggaagtctactttctcgcccatctccgacatcggcctggccaagtctgcagacagcccg
ctgcaggccagctccgccctcagccagaactccctgttcacgttccggcccgccctggag
gagccccctgccgatgccaagctggccacccaccccaggaaaggctttcctggctctctg
tcgggggctgacggactcagcccgagcaccaaccctgccaacggctgcacctttggcggg
ggcctggccgcggacctgagtttacacagcttcagcgatggtgcttctcttccccacaag
ggccccgaggcagccggcctgagctccccactgagcttcccctcgcagcgtggcaaggag
gcctcggacgccaaccctttcctgagcaagaggcagctggatggcctggctgggctgaag
ggcgagggcagccgcagcaaggaggcaggggagggcggcctgcagctgtgcgggcccaca
gacaagaccccgctgctgaccggcaaggccgccaaggcccgggaccgcgagcttgacctc
aagaatggccacaacctcttcatctccgctgcggctgtgcctcctggaagcctcctcagc
ggccccggccttgccccggtggcgtcctccacaggcggcgcggcgtcctccacccagacg
caccggcccttcttgggccccttcccgccgggaccgcagttcgcgctcggccccatgtcc
ctgcaggccaacctcggctccgtggccggctcctctgtgctgcagtcgctgttcagctct
gtgccggccgccgcaggcctggtgcacgtgtcgtccgctgccaccagactgaccaactcg
catgccatgggcagcttttccggggtggcaggcagcacagttggaggtgtctttaaccac
gcggtgccttccgcctctgctcatccgtttggagcccgtgtcggccgcggggctgcatgt
ggcagcgccacgctgggcccgagcccgctgcaggcggcggcctcttcctttcaggccccg
gcctcggttgagacccggccgccccctccgcctccgcctcccccgctgcccccgcctgcg
cacctgggccggccccccgcggggccgcctgtcctccacgccccgcctccacctaacgcc
gccttgcctcctcccccaacgctgctggcctctaaccctgagcccgcgcttctgcagagc
ctcgcgtccctcccgcctaaccaagctttcttgcccccaacctctgctgcctctctgccg
cctgctaacgcctctttgtctatcaagctcacctccctcccgcacaagggcgcccgcccc
tccttcacggtgcaccaccagcccctgccccggctggccctggcccaggccgcgcccggg
atcccgcaggccagcgccacggggccgtccgcggtgtgggtgtccctcggcatgccgcct
ccctatgccgcgcacctttcgggggttaagccgcgataa

DBGET integrated database retrieval system