KEGG   Macaca fascicularis (crab-eating macaque): 101926822Help
Entry
101926822         CDS       T02918                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Alcoholism
Human papillomavirus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101926822 (HDAC6)
  Substance dependence
   05034 Alcoholism
    101926822 (HDAC6)
  Infectious diseases
   05165 Human papillomavirus infection
    101926822 (HDAC6)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101926822 (HDAC6)
Protein phosphatases and associated proteins [BR:mcf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101926822 (HDAC6)
Messenger RNA biogenesis [BR:mcf03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101926822 (HDAC6)
Membrane trafficking [BR:mcf04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    101926822 (HDAC6)
Chromosome [BR:mcf03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101926822 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
X
AA seq 1261 aa AA seqDB search
MEKKGQGARVPTGRQKLGGASQGRSLRKGLRPNRGRGQASSTMTSTGQDSTTTRQRRSRQ
NPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIAGLQGMDLNL
EAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEK
EELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAV
LGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQ
GTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDAD
YIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKL
ILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVL
VRSSRKWAETVEGDNMEEDNVEENEEEGPWEPPVLPILTWPVLQSRTGLVYDQSMMNHCN
LWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSAEYVGHLRATEKM
KTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLNGAAVVRPPGHHAEQ
DAACGFCFFNSVAVAARHAQAISGRALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRY
DHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPEL
VLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEGGYNLTSISESMAAC
TRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVEDREGPSSSKLVTKK
APQPAKPRLAERMTTREKKVLEAGMGKITSASSGEESTPGQTKSETAVVALTQDQSSEAA
TGGATLAQTISEAAVGGAMLGQTTSEEAVGGATPDQTTSEKTVGGATLDQTTSEDAVGGA
TLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPT
SPVQGTTPQISPSTLIENLRTLELGSKSQGASESQAPGEENLLGEAAGGQDMADSMLMQG
SRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCG
RYINGHMLQHHENSGHPLVLSYIDLSTWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHP
H
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaaggccagggcgctcgcgtccccacgggtcgccagaaacttggcggagcg
agccaagggcggagtttgagaaaggggctgcgtccaaaccgcggcaggggtcaagcctcc
tcaactatgacctcaaccggccaggattctaccacaaccaggcagcgaagaagtaggcag
aacccccaatctccccctcaggactccagtgtcacttcgaagcgaaacattaaaaaggga
gccgttccccgctccatccccaatctagcggaggtaaagaagaaaggcaaaatgaagaag
ctcggccaagcaatggaagaagacctaatcgcgggactgcaagggatggatctgaacctt
gaggctgaagcactggctggcactggcttggtgttggatgagcagttaaatgaattccat
tgcctctgggatgacagcttcccggaaggccctgagcggctccatgccatcaaagagcaa
ctgatccaggagggcctcctagatcgctgtgtgtcctttcaggcccggtttgctgaaaag
gaagagctgatgttggttcacagcctagaatatattgatctgatggaaacaactcagtac
atgaatgagggagaactccgcgtcctagcagacacttacgactcagtttatctgcatccg
aactcatactcctgtgcctgcctggcctcaggctctgtcctcaggctggtggatgcggtc
ctgggggctgagatccggaatggcatggccatcattaggcctcctggacatcatgcccag
cacagtcttatggatggctattgcatgttcaaccacgtggctgtggcagcccgctatgct
caacagaaacaccgcatccggagggtccttatcgtagattgggatgtgcaccacggtcaa
ggaacacagttcaccttcgaccaggaccccagtgtcctctatttctccatccaccgctat
gagcagggtaggttctggccccacctgaaggcctctaactggtccaccacaggtttcggc
caaggccaaggatataccatcaatgtgccttggaaccaggtggggatgcgggatgctgac
tacattgctgctttcttgcacgtcctgctgccagtcgccctcgagttccagcctcagctg
gtcctggtggctgctggatttgatgccctgcaaggggaccccaagggtgagatggccgcc
actccggcagggttcgcccagctaacccacctgctcatgggtctggcaggaggcaagctg
atactgtctctggagggtggctacaacctccgcgccctggctgaaggtgtcagtgcttcg
ctccacacccttctgggagacccttgccccatgctggagtcacctggtgccccctgccgg
agtgcccaggcttcagtctcctgtgctctggaagcccttgagcccttctgggaggttctt
gtgagatcaagtaggaagtgggctgagactgtggagggggacaacatggaggaggacaat
gtagaggagaatgaggaggaaggaccctgggagccccctgtgctcccaatcctgacgtgg
ccagtgctacagtctcgcacagggctggtctatgaccaaagtatgatgaatcactgcaac
ttgtgggacagccaccaccctgaggtaccacagcgcatcttgcggatcatgtgccgtctg
gaggagctgggccttgctgggcgctgcctcaccctgacaccgcgccccgccacagaggct
gagctgctcacctgccacagtgctgagtatgtgggtcatctccgggccacagagaaaatg
aaaacccgggagctgcaccgtgagagttccaactttgactccatctacatctgccccagt
accttcgcctgtgcacagcttgccactggcgctgcctgccgcctggtggaggctgtgctc
tcgggagaggttctgaatggtgctgctgtggtgcgtcccccaggacaccacgcggagcag
gatgcagcttgcggtttttgctttttcaactccgtggctgtggctgctcgccatgcccag
gctatcagtgggcgtgccctgcggatcctgattgtggattgggatgtccaccatggtaat
ggaactcagcacatgtttgaggatgaccccagtgtgctatatgtgtccctgcaccgctat
gatcatggcaccttcttccccatgggggatgagggtgccagcagccagatcggccgggct
gctggcacaggcttcaccgtcaacgtggcatggaacgggccccgcatgggtgacgctgac
tacctagctgcctggcatcgcctggtgcttcccattgcctacgagtttaacccagaactg
gtgctggtctcagctggctttgatgctgcacggggggacccgctggggggctgccaggtg
tcacctgagggttatgcccacctcacccacctgctgatgggccttgccagtggccgcatt
atccttattctagagggtggctataacctgacatccatctcagagtccatggctgcctgc
actcgctccctccttggagacccgccacccctgctgaccctgccacggccccctctatca
ggggccctggcctcaatcactgagaccatccaagtccatcgcagatactggcgcagctta
cgggtcatgaaggtagaagacagagagggaccctccagttctaagttggtcaccaagaag
gcaccccaaccagccaaacctaggttagctgagcggatgaccacacgagaaaagaaggtt
ctggaagcaggcatgggaaagatcacctcggcatcatctggggaagagtccactccaggc
cagactaagtcagagacagctgtggtggccctcactcaggaccagtcctcagaggcagcc
acagggggagccacactggcccagaccatctctgaggcagccgttgggggagccatgctg
ggccagaccacctcagaggaggctgtcgggggagccactccggaccagaccacctcagag
aagactgtgggaggagccactctggaccagaccacctcagaggatgctgttgggggagcc
acgctgggccagactacctcagaggaggctgtaggaggagctacactggcccagaccacc
tcggaggcagccatggagggagccacactggaccagactacgtcagaggaggctccaggg
ggcaccgagctgatccaaactcctctagcctcgagcacagaccaccagacccccccaacc
tcacctgtgcagggaactacaccccagatatctcccagtacactgattgagaatctcagg
accttggagctaggcagcaaatctcagggggcctcagaatctcaggccccaggagaggag
aacctactaggagaggcagctggaggtcaggacatggctgattcgatgctgatgcaggga
tctaggggcctcactgatcaggccatattttatgctgtgacaccactgccctggtgtccc
catttggtggcagtatgccccatacctgcagcaggcctagacgtgacccaaccttgtggg
gactgtggaacaatccaagagaattgggtgtgtctctcttgctatcaggtctactgtggt
cgttacatcaatggccacatgctccaacaccatgaaaattctggacacccgctggtcctc
agctacatcgacctgtcaacctggtgttactactgtcaggcctatgtccaccaccaggct
ctcctagatgtgaagaacatcgcccaccagaacaagtttggggaggatatgccccaccca
cactaa

DBGET integrated database retrieval system