KEGG   Macaca fascicularis (crab-eating macaque): 102116234Help
Entry
102116234         CDS       T02918                                 

Gene name
TUFM
Definition
(RefSeq) Tu translation elongation factor, mitochondrial
  KO
K02358  elongation factor Tu
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Translation factors [BR:mcf03012]
 Eukaryotic Type
  Elongation factors
   102116234 (TUFM)
 Prokaryotic Type
   102116234 (TUFM)
Mitochondrial biogenesis [BR:mcf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    102116234 (TUFM)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102116234 (TUFM)
  Exosomal proteins of breast cancer cells
   102116234 (TUFM)
  Exosomal proteins of colorectal cancer cells
   102116234 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 102116234
NCBI-ProteinID: XP_005591608
UniProt: A0A2K5W255
LinkDB All DBs
Position
20
AA seq 455 aa AA seqDB search
MTTMAAATLLRATPHFSGLATGRTFLLQGLLRPLKTPALPLLCRGLAVEAKKTYVRDKPH
VNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYST
AARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVV
VYVNKADAVQDSEMVELVELEIRELLTEFGYKGEATPVIVGSALCALEGRDPELGLKSVQ
KLLDAVDTYIPVPTRDLEKPFLLPVEGVFSVPGRGTVVTGTLERGILKKGDECELLGHSK
NIRTVVTGIEMFHKNLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIKPHQKVEAQVY
ILSKEEGGRHKPFVSHFMPIMFSLTWDMACRVILPPEKELAMPGEDLKFNLILRQPMILE
KGQRFTLRDGNRTIGTGLVTDTLAMTEEEKNIKWG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaatggcggcagccaccctgctgcgcgcgacgccccacttcagcggtctcgcc
accggccggaccttcctgctgcagggtctgttgcggccgctgaagactccggcattgcct
ctcttgtgccgcggcctggccgtggaggccaagaagacttacgtgcgcgacaagccacat
gtgaatgtgggtaccatcggccatgtggaccacggcaagaccacgctgactgcagccatc
acgaagattctagccgagggaggtggggctaaattcaagaagtatgaggagattgacaat
gccccggaggagcgagctcggggtatcaccatcaatgcggcccatgtggagtatagcact
gccgcccgccactacgcccacacagactgcccgggtcatgcagattatgttaagaatatg
atcacaggcactgcacccctcgacggctgcatcctggttgtagcagccaatgatggcccc
atgccccagacccgagagcacttattactggccagacagattggggtggagcatgtggtg
gtgtatgtgaacaaggctgatgctgtccaggactctgagatggtggagctggtggagctg
gagatccgggagctgctcaccgagtttggctataaaggggaggcgaccccagtcatcgta
ggctctgctctctgtgcccttgagggtcgggaccctgaattaggcctgaagtctgtgcag
aagctactggatgctgtggacacttacatcccagtgcccacccgggacctggagaagcct
ttcctgctgcctgtagagggggtgttctccgtccctggccgtggcactgtggtgacaggt
acgctagagcgtggcattttaaagaagggagacgagtgtgagctcctaggacacagcaag
aacatccgcactgtggtgacaggcattgagatgttccacaagaacctggagagggccgag
gccggagataacctcggggccctggttcgaggcttgaagcgggaggacttgcggcggggc
ctggtcatggtcaagccgggttccatcaagccccaccagaaggtggaggcccaggtttac
atcctcagcaaggaggaaggtggccgccacaagccctttgtgtcccacttcatgcctatc
atgttctccctgacttgggacatggcctgtcgggttatcctgcccccagagaaggagctt
gccatgcccggggaggacctgaagttcaacctaatcttgcggcagccaatgatcttggag
aaaggccagcgtttcaccctgcgagatggcaaccggactatcggcaccggtctagtcacc
gacacgctggccatgactgaggaggagaagaacatcaagtggggttga

DBGET integrated database retrieval system