KEGG   Macaca fascicularis (crab-eating macaque): 102119163Help
Entry
102119163         CDS       T02918                                 

Gene name
GLB1, Lactase, QccE-17236
Definition
(RefSeq) galactosidase beta 1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00052  Galactose metabolism
mcf00511  Other glycan degradation
mcf00531  Glycosaminoglycan degradation
mcf00600  Sphingolipid metabolism
mcf00604  Glycosphingolipid biosynthesis - ganglio series
mcf01100  Metabolic pathways
mcf04142  Lysosome
Module
mcf_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    102119163 (GLB1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    102119163 (GLB1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    102119163 (GLB1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    102119163 (GLB1)
   00511 Other glycan degradation
    102119163 (GLB1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    102119163 (GLB1)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     102119163 (GLB1)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102119163 (GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 102119163
NCBI-ProteinID: NP_001306360
UniProt: Q60HF6
LinkDB All DBs
Position
2
AA seq 682 aa AA seqDB search
MPGFLVRILPLLLPLLLLGPTRGLRNATRRVFEIAYSQDRFLKDGQPFRYISGSIHYSRV
PRFYWKDRLLKMKMAGLNTIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVIL
RPGPYICAEWEMGGLPAWLLEKEAILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPI
ITVQVENEYGSYFACDFDYLRFLQKRFHHHLGDDVVLFTTDGAHETFLQCGALQGLYTTV
DFGPGSNITDAFQIQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEVVASSLYDILARG
ASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNVIQKFEKV
PEGPIPPSTPKFAYGKVSLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQYYGFVLYRT
TLPQDCSNSTPLSSPFNGVHDRAYVAVDGIPQGVLERNRVITLNITGKTGATLDLLVENM
GRVNYGAYINDFKGLVSNLTLDSNILTGWTIFPLDTEDAVRSHLGGWEHRDSGRHDEAWA
HSSSNYTLPAFYVGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLT
LFVPQHILMTSAPNTITVLELERAPCSSDGPELCAVEFVDRPVIGSSQIYDHLSKPVEQR
LMAPPPKKTKIRGWSMYDDESL
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgccggggttcctggttcgcatcctccctctgctgctgcctctgctgcttctgggccct
acgcgcggcttgcggaatgccacccggagggtgtttgaaattgcctatagccaagaccgc
ttcctcaaggatggccagccgtttcgctacatctcaggaagcattcactactcccgcgtc
ccccgcttctactggaaggaccggctgctgaagatgaagatggctgggctgaacaccatc
cagacgtatgtgccctggaactttcatgagccctggccaggacagtaccagttttctgag
gaccatgatgtggaatattttcttcggctggctcacgagctgggactgctggttatcctg
aggcccggaccctacatctgtgcggagtgggaaatgggaggattacctgcttggctgcta
gagaaagaggctattcttctccgctcttccgacccagattacctggcagctgtggacaag
tggttgggagtccttctgcccaagatgaagcctctcctctatcagaatggagggccaatt
ataacagtgcaggttgaaaatgaatatggcagctacttcgcctgtgattttgactacctg
cgcttcctgcagaagcgctttcaccaccatctgggggatgatgtggttctgttcaccacg
gacggcgcacatgagacattcctgcaatgtggggccctgcagggcctctacaccacggtg
gactttggaccaggcagcaacatcacagatgctttccaaatccagaggaagtgtgagccc
aaaggacccttgatcaattctgaattctatactggctggctagaccactggggccaacct
cactccacaatcaagactgaagtggtggcttcctccctgtatgatatacttgcccgtggg
gcgagtgtgaacttgtacatgtttataggtgggaccaattttgcctattggaatggggcc
aactcaccctatgcagcccagcccaccagctacgactatgatgccccactgagtgaggcc
ggggacctcactgagaagtattttgctctgcgaaacgttatccagaagtttgaaaaagta
ccagaaggtcctatccctccatctacaccaaagtttgcatatggaaaggtctctctggaa
aagttaaagacagtgggagcagctctggacattctgtgcccctctgggcccatcaaaagc
ctttatcccttgacatttatccaggtgaaacagtattatgggtttgtgctataccggaca
acacttcctcaagattgcagcaactcaacacctctctcttcacccttcaatggagtccac
gatcgagcgtatgttgctgtggatgggatcccccagggagtccttgagcgaaacagggtg
atcactctgaacataacagggaaaactggagccactctggaccttctggtagagaatatg
ggacgtgtgaactatggcgcatatatcaacgattttaagggtttggtttctaacctgacc
ctcgattccaatatcctcaccggctggacgatcttcccactggacactgaggatgcagtg
cgcagccacctcgggggctgggaacaccgtgacagtggccgccacgatgaagcctgggcc
cacagctcatccaactacacgctcccggccttttatgtggggaacttctccattcccagt
gggatcccagacttgccccaggacacctttatccagtttcctggatggaccaagggccag
gtctggattaatggctttaaccttggccgctattggccagcccggggccctcagttgacc
ttgtttgtgccccagcacatcctgatgacctcagccccaaacaccatcaccgtgctggaa
ctggagcgcgcaccctgcagcagtgatggtccagaactgtgtgctgtggagttcgtggac
aggccagttattggctcatctcagatctacgatcatctctccaaacctgttgagcaaaga
ctcatggccccaccccccaaaaaaacaaagattcgtggctggagcatgtatgatgatgaa
agcctgtga

DBGET integrated database retrieval system