KEGG   Macaca fascicularis (crab-eating macaque): 102129692Help
Entry
102129692         CDS       T02918                                 

Definition
(RefSeq) trypsin-2-like
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102129692
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    102129692
   04974 Protein digestion and absorption
    102129692
 Human Diseases
  Infectious diseases
   05164 Influenza A
    102129692
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102129692
Peptidases [BR:mcf01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102129692
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102129692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
3
AA seq 248 aa AA seqDB search
MNPLLILAFVGAAVAVPFDDDDKIVGGYTCEENSVPYQVSLNSGYHFCGGSLIREQWVVS
AGHCWKLGRIQVRLGEHNIEVLEGNEQFINAAKKIRHPKYNRKTLDNDILLIKLSTPAVI
NDHVSTIPLPTAPPAAGAEALISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKI
TSNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNKPGVYTKVYNYVDWI
EDTIAANS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatccttgcctttgtgggagctgctgttgctgtcccctttgatgat
gatgacaagatcgttgggggctacacctgtgaggagaattctgtcccctaccaggtgtcc
ctgaattctggctaccacttctgtggtggctccctcatcagggagcagtgggtggtgtca
gcaggtcactgctggaagctcggacgcatccaggtgagactgggagaacacaacatcgaa
gtcctggaagggaatgagcagttcatcaatgcagccaagaaaattcgccaccccaaatac
aacaggaagactctggacaatgacatcctgctgatcaagctctccacacctgccgtcatc
aatgaccatgtgtccaccatccctctgcccaccgcccctccagctgctggcgccgaggcc
ctcatctctggctggggcaacactctgagctctggtgccgactacccagacgagctgcag
tgcctggatgctcctgtgctgtcccaggctgagtgtgaagcctcctaccctgggaagatt
accagcaacatgttctgtgtgggcttccttgagggaggcaaggattcctgccagggtgac
tctggtggccctgtggtctccaacggagagctccaaggaattgtctcctggggctatggc
tgtgcccagaagaacaagcctggagtctacaccaaggtctacaactatgtggactggatt
gaagacaccatagctgccaacagctaa

DBGET integrated database retrieval system