KEGG   Macaca fascicularis (crab-eating macaque): 102143028Help
Entry
102143028         CDS       T02918                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00590  Arachidonic acid metabolism
mcf01100  Metabolic pathways
mcf04064  NF-kappa B signaling pathway
mcf04370  VEGF signaling pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04657  IL-17 signaling pathway
mcf04668  TNF signaling pathway
mcf04723  Retrograde endocannabinoid signaling
mcf04726  Serotonergic synapse
mcf04913  Ovarian steroidogenesis
mcf04921  Oxytocin signaling pathway
mcf04923  Regulation of lipolysis in adipocytes
mcf05140  Leishmaniasis
mcf05165  Human papillomavirus infection
mcf05167  Kaposi's sarcoma-associated herpesvirus infection
mcf05200  Pathways in cancer
mcf05204  Chemical carcinogenesis
mcf05206  MicroRNAs in cancer
mcf05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102143028 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    102143028 (PTGS2)
   04064 NF-kappa B signaling pathway
    102143028 (PTGS2)
   04668 TNF signaling pathway
    102143028 (PTGS2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    102143028 (PTGS2)
   04657 IL-17 signaling pathway
    102143028 (PTGS2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102143028 (PTGS2)
   04913 Ovarian Steroidogenesis
    102143028 (PTGS2)
   04921 Oxytocin signaling pathway
    102143028 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    102143028 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    102143028 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102143028 (PTGS2)
   05206 MicroRNAs in cancer
    102143028 (PTGS2)
   05204 Chemical carcinogenesis
    102143028 (PTGS2)
   05222 Small cell lung cancer
    102143028 (PTGS2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    102143028 (PTGS2)
   05165 Human papillomavirus infection
    102143028 (PTGS2)
   05140 Leishmaniasis
    102143028 (PTGS2)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102143028 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 102143028
NCBI-ProteinID: XP_005540313
UniProt: A0A2K5UM46
LinkDB All DBs
Position
1
AA seq 604 aa AA seqDB search
MLARALLLCAVLALGHAANPCCSYPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLLLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNVDY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDNFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSRLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctgtgcgcagtcctggcactcggccacgcagcaaatcct
tgctgttcctacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccaatat
aagtgcgattgtacccggacaggattctatggtgaaaactgctcaacaccggaatttctg
acaagaataaaattacttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacgttgtgaataacattcccttccttcgaaatgcaattatgagt
tatgtgttgacgtccagatcacatttgattgacagtccaccaacttacaatgttgactat
ggctacaaaagctgggaagccttctctaacctctcctattataccagagcccttcctcct
gtgcctgatgactgcccaactcccttgggtgtgaaaggtaagaagcagcttcctgattca
aatgagattgtggaaaaatttcttctaagaagaaagttcatccctgatccccagggcaca
aacatgatgtttgcattctttgcccagcacttcacgcatcagtttttcaagacagatcat
aagcgagggccagctttcaccaaagggctgggccatggggtggacttaaatcatatttat
ggtgaaactctggatagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagtccctgagcatctgcggtttgctgtggggcaggaggtctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgagaacacaacagagtgtgcgat
gtgcttaaacaggagcatccggaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagattatgtacaacacttgagtggc
tatcacttcaaactgaaatttgacccagaactacttttcaacaaacaattccagtaccaa
aatcgtattgctgctgagtttaacaccctctatcactggcatccccttctgcctgacaac
tttcaaattcatgaccagaaatacaactatcaacagtttatctacaacaactctatatta
ctggaacatggaattacccagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatgttccacccgcagtacaaaaagtatcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tatggtgacatcgatgctgtggagctgtatcctgcccttctggtagaaaagcctcgtcca
gatgccatctttggtgagaccatggtagaagttggagcaccattctccttgaaaggactt
atgggtaatgttatatgttctcctgcctactggaagccaagcacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttacttcattcagtgttccagatccagagctcatcaaaacagttaccatcaat
gcaagttcttctcgctccagactagatgatatcaatcccacagtactactaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system