KEGG   Momordica charantia (bitter melon): 111011870Help
Entry
111011870         CDS       T05045                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH2
Organism
mcha  Momordica charantia (bitter melon)
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW
Motif
Other DBs
NCBI-GeneID: 111011870
NCBI-ProteinID: XP_022141511
LinkDB All DBs
Position
Unknown
AA seq 2082 aa AA seqDB search
MGSCDDPAVIGEPFRGSVTQLVRCSSQPLPKQQSRQKMTSCPSNYSEGQMFESDRGLGAL
ATNICTNSSEPAAAGEDGTFRGSEHADTLILDERLDSDSGVSDPFLNEENDACNLENRTL
SLDTKESQDVDGIVGISGCRTTMDMVSLTGSSANCVKPDELDDNSCVIAESSKVERDDTV
DDSPILEQMGTCTDDLKSPSHVSEIVSNLASANGFPSDFIQIQQNKPDNDGAGCSFSDSV
DRITDASVEIVADMLNEMSPLQSDQILSIHVGQSVANYDQYICQMDGKSLSGTSGETVTE
VADMNSNPESCLQVLPSQGCQRIREYLQSDGSLTIHSPENDGCDENHVSNSSKYIPKVVE
EDIDILTYDNGDAREHIVHKIENDCNLEEAIFRVNPNCVELLALPLPSQPPDFGKDGFYE
MLSAEDILIKDISSVNSCDVGCQDNNDIEKVGCVSEVKCPETVVLSSKRSGRRRASSQKS
LTKRALRKSKKKLPQPLIFDTSRKRRSSISRPARPSPWGSLGYIIQSFEKSDNDLVNQSQ
KQGNKKSKGNQGGTKRNKKQASDSSHRSRKGTQGKCATSTNCIRLKVKLGKNSGHNFLNI
MVPEVADSSLSAKGISCNYGNESYWEGNLEFPRLTHGVDDQKPEEGPLRKIFCYNRNQEK
EEICPDGSVVKEQCVNNDSSFTVIAEKSSEKHADDNHCISSHLVEPVERAGDTRSLDPGT
SPDSEVINSILDIQVGAMRQETLQDSVLASSEDFAASGNVTSSKKGRKKSKSNQVVSCSQ
EGGSSAPPCRNRSKSSKKHGRRRNVENQLGSSETFTSTGANVLNYSLNSKELSMEQVPLS
TEIAFPEEALKADGILKVKECSKIDVGGVFSESENSKTLFPTQSARKKHPKISKSVKTSK
GKYKAPGSRNNIKNASKEKVYQRKSVNKSKIKKAICDQAVTGMESHQVAGNCLVDKPDKS
DDIIASTVAVNLNSVQGAVSEQYTPPRDAWVLCDDCHKWRRIPASLVDSLGHASCTWTCK
DNVDKAFADCSIPQEKSNSEINAELEISDESGEENASNKRLTYRELGSFHPTTVNAVPQE
NKFASISSNQFLHRSRKTQTIDEIMVCHCKPALDGRLGCGDECLNRMLNIECVRGTCPCG
DLCSNQQFQKRKYAKLRWVRCGKKGYGLQLLDNISKGQFLIEYVGEVLDMHAYEARQKDY
ALNGHRHFYFMTLNGSEVIDACGKGNLGRFINHSCDPNCRTEKWMVNGEICIGLFALRDI
KKGEEVTFDYNYVRVFGAAAKKCYCGSSQCRGYIGGDPLNSEVIIQSDSDEEFPEPVMLR
AYGRSLNNNLPTVVRSSDGAETQPSESMTAVKDKIDQPSSIAIIEPKISEEKEDPPSLSA
STVSPLHSSLEFEDSKVVSPATLLPETTQHTEDVTSKAVFVDQTEISPVGNTSNKNTCSI
ESVAKSLFDDIDARKKSKLDAGEDKQVHLKPYPCMKTSRKPGSIKKGKVSSVEKVQMTNK
PQISSFKPKRLIEGSPSNRFEAVEEKLNELLDAEGGISKRKDAPKGYLKLLLLTAASGAS
GSGEAIQSNRDLSMILDALLKTKSRVVLTDIINKNGLRMLHNIMKQYRSDFKKIPILRKL
LKVLEYLVAREILTSEHINGGPPCPGMESLRESLLSLTEHDDKQVHQIARSFRDRWFPRP
VRKFGYTEREDGRLEVYRGSNCSRFTVSHSYRHDLDSRPTEAIDCVKQSMPTSLPDTHPA
DICSVASTGGQSSSGQKNRKRKSRWDQPADTNLDLRSKEQKLESSLVQHFDSSQLNSVGV
APMLIDKVNGDDKDSSLSDLVCCRQEEDIKADSTVQDVPEDIPPGFSSPFNPPLASSSAF
STVLDPSQQSTGNLSCAFSTVGHPQERFISRLPVSYGIPFSIVQQYGTSHAENLECWDVA
PGMPFHPFPPLPPYPRGEKGPPMSACGTAIRQSAQQGQVNSHDSRTSFSEESTPSTSTNV
QQDLCIPLNNQQILKRVKESSYDLGRRYFRQQKWRNTKFGPPWLQRRSQWGYQGNFRSGS
SAISDDNVLNEGINPYCSDEASVRADKANDDFYQHSLNQNQR
NT seq 6249 nt NT seq  +upstreamnt  +downstreamnt
atgggttcatgtgacgacccggctgtgatcggggaaccgtttcgaggctctgttactcag
ttggtccgctgttcgagtcaacctcttcccaagcagcagtctcgtcagaagatgacttcc
tgtccatctaattatagtgagggtcagatgtttgaatcagataggggactgggagcgcta
gcgactaatatctgcacgaattcatcagagccagctgctgctggggaggatgggacattc
agaggctccgaacatgcagatactttaatattggatgaaaggttggatagtgattccggc
gtcagtgatccctttctaaacgaggagaatgacgcttgcaacttggagaatagaacattg
agcttggatacgaaagagtctcaagatgtcgatggtatagttggtatctcaggctgtaga
acgaccatggatatggtgtccttgactgggtcatcggcaaactgtgtcaagcctgatgaa
ctggatgataatagttgtgtaattgctgagtcttcaaaagttgaaagagatgacactgta
gacgatagtccaattttagaacaaatgggtacttgtacagatgacttaaaatctccttct
catgtcagtgaaattgtttctaatttagcttctgccaatggatttccaagtgatttcata
cagatacaacaaaacaagccggataatgatggtgctggttgttcattttcagattctgtg
gacaggataacggatgcttcagttgaaatagtagcagacatgttgaatgagatgtcccct
ttacagagtgatcaaatactatcaatacatgtaggacaatcagttgcgaattatgaccag
tatatttgccagatggatggaaagagcttaagtggtacctctggagaaacagttactgaa
gtagctgatatgaacagcaatcctgaatcgtgcttgcaagtgttgccttcacaaggctgc
cagaggatcagggaatacctgcaatctgatggttcactaaccatccactctccagagaac
gatggatgcgatgaaaatcatgtcagtaattcttcaaagtacattccaaaggtcgtggaa
gaagatattgatattttgacttatgataatggtgatgctagagaacatatagttcacaag
attgaaaatgactgcaatctggaggaagctatttttcgagtgaaccccaattgtgttgag
ctactagctttgcccttgccttctcagccccctgattttggaaaagatggattttatgag
atgttgagtgcagaagatattctaataaaggatattagttctgttaattcttgcgatgtt
ggttgtcaagacaacaatgacatagagaaagttggctgtgtttctgaagtgaaatgtccc
gaaacagttgtcctgtcttctaagaggagtggccgaaggagagcatcaagccaaaaaagt
ttgacaaaaagggcacttaggaaaagcaaaaaaaaattgcctcagccactgatttttgac
acttcaagaaagaggaggagctctatatctaggcctgctcgtccttctccttggggatca
ctgggctatattattcagtcatttgaaaaaagtgacaatgatctagtaaatcaaagccag
aaacaaggaaataagaaatctaaaggtaatcaaggaggtaccaagcggaataagaaacag
gcaagtgatagttcacatagatcaagaaaagggacccaaggaaaatgtgctacttcaacc
aattgtattcgtttgaaggttaaattagggaagaattcgggtcataattttctgaacatt
atggttccagaggttgctgattcatcattgtctgccaagggtatcagttgcaattatggg
aatgaatcatattgggaaggtaatttggaatttcctcgattaacccatggtgttgacgat
caaaagcccgaagaggggcctttaagaaaaatcttttgctataataggaatcaggagaaa
gaagagatatgtcctgatggttctgttgtgaaggaacaatgtgttaataatgactcaagt
ttcaccgttattgcggaaaagtcatctgaaaaacacgcagatgataatcattgcatttcc
tctcatttggttgagccagtagaaagggcaggtgatacaaggagtttggatcctggaact
tcacctgattcagaagtgataaattcaattttagatattcaagttggagcaatgcgacaa
gaaactttgcaggactcagttttggcatcctcagaagattttgcagcttccggaaatgtt
accagtagtaagaaaggaaggaagaagtcaaagtccaatcaggtagttagttgttctcag
gagggtggctcgagtgctcctccttgcagaaataggtccaaatcgtcaaagaagcatgga
agaagacggaatgtggaaaatcagcttggttccagtgagacatttacttccactggtgca
aatgttttaaactactctttaaatagtaaggaattgtctatggagcaagtgcctttgtcg
acggagattgcattcccagaagaggctttgaaggcagatgggattctcaaagttaaagaa
tgtagcaaaatagatgttggcggtgtgttttctgaatcagagaattcaaaaacattgttt
cctactcaatctgcaaggaagaaacatcctaaaatttctaaatctgttaaaacaagcaaa
ggcaagtacaaggctcctggctcaagaaacaacataaagaatgcttctaaagagaaggtt
taccaacggaagtctgttaataagagtaaaatcaagaaggctatatgtgaccaagctgtg
actggaatggaaagtcaccaagtagcaggaaattgccttgtagacaagcctgataaaagc
gatgacatcattgcatccacagtggcagtgaatttgaattctgtacaaggtgctgtgagt
gagcagtatacaccccctcgtgatgcttgggtgctctgtgatgattgtcataaatggcga
cgcataccagcttctcttgttgatagtttaggacatgcaagttgcacatggacctgtaag
gacaatgtggataaagcttttgctgattgctcaatcccacaagagaagtcaaattctgag
attaatgcagagttagagatatcagatgaatctggggaagaaaatgcttccaataaacgg
ctaacttatagggaattagggagttttcatccaacaacagtgaatgcagttccccaagag
aacaaatttgcttccattagcagcaatcagtttttgcaccgtagtcgtaaaactcagact
attgatgagataatggtttgtcattgcaaaccagctttggatggtcgattaggttgtggg
gatgaatgcttgaatagaatgctcaacattgaatgtgttcgaggtacatgtccttgtgga
gacctttgttctaatcaacagttccagaaacgcaagtatgccaaattacggtgggtgcga
tgtggaaagaagggttatgggctacagttgcttgacaatatatcaaaagggcaatttctc
attgagtatgttggagaggtccttgatatgcatgcttatgaggcacgtcaaaaggattat
gcattgaatggtcatcgacatttctacttcatgacactaaatggcagtgaggtaatagat
gcatgtggaaaggggaatttggggcgtttcattaaccacagttgtgatccaaattgtcgc
acagagaagtggatggtgaatggagaaatttgcattgggctctttgcactaagggatatt
aagaagggtgaagaggtgacatttgactacaattatgtaagggtatttggggccgctgcc
aaaaaatgttattgtggttcttcccaatgtcgaggttatataggtggagatcccctcaat
tctgaagtcattattcagagtgattcagacgaagaatttccagaaccagtaatgcttcgt
gcatatggcagaagtttgaataataacttgccaactgtagttcgttcatcagatggtgct
gaaacgcaaccctcagagagtatgacagcggttaaggataagatcgatcagcctagtagt
attgctatcatcgaaccgaagatttcagaagaaaaagaagatcctcctagcctttctgcc
tctactgtttcaccattgcatagttcattggaatttgaagactcgaaggttgtatcacct
gctacacttttgccagaaactacccaacatactgaagatgtgacaagcaaagccgtgttt
gttgatcagacagaaatatctcctgtaggcaatacttctaacaagaacacatgctctatt
gagtcggtggcaaagtcgctatttgatgacattgatgctcgtaagaagtccaagctggat
gcaggtgaagataagcaagtacatttaaagccatatccttgcatgaaaacttcacgaaaa
ccaggttccattaagaaaggaaaagttagctctgtagaaaaagttcaaatgactaacaag
ccccagatttcgtctttcaagccaaaacgattgattgaaggttctcctagcaaccgcttt
gaagcagtcgaggagaagcttaatgaactcctggatgctgaagggggaataagcaaaaga
aaagatgcccctaaaggctacttaaagcttctgctcctgactgctgcatcaggtgcaagt
ggtagtggtgaagcaattcagagcaatagagatctttcaatgatccttgatgctcttttg
aagacaaaatcacgagtagtattgaccgacataataaacaaaaatggtttgcggatgctg
cataatataatgaagcaatacagaagtgacttcaaaaagatccctattcttcggaagctt
ctgaaggtactagaatacttggtagcaagagagatactcacttctgaacatattaatgga
ggtcctccttgccccggaatggaaagtttgagagagtccttactgtcactgacggagcat
gatgacaaacaggtacatcaaattgcccgaagttttcgagacagatggtttcccagacct
gttagaaaatttggttacaccgagagggaggatgggagattggaagtttacaggggttca
aactgcagtaggtttacagtatcacacagttaccggcatgatctggattccagacccaca
gaagcgattgactgtgttaagcagtcaatgcctacatctctgccagatactcatcctgca
gacatctgttctgtggcttctacaggtggccagtcgtcaagtgggcaaaaaaatcgcaag
cgtaagagtcgatgggatcaacctgcagacacaaacctagatctgagatccaaggagcag
aagcttgaatcatcattggtgcagcactttgattccagccaattaaatagtgttggagtg
gcaccaatgttgatagacaaggtaaatggtgatgataaggactcctccctctctgactta
gtttgttgtcgccaagaagaagatattaaggcagacagtacagtgcaagatgtacctgaa
gatattcctcctggattttcatctcctttcaatccccccctggcttcctcaagtgctttc
tcaacagttttagatccttctcaacagagtactggaaatttgagttgtgctttttccaca
gttgggcatccacaggagagattcatttctcgcttgcctgtgtcttacggaattccgttt
tctatcgttcagcaatatggaacatcccatgcagagaatctggagtgttgggatgttgct
cctggaatgccttttcacccttttccacccttgccaccatatcctcgaggtgagaaaggc
ccaccaatgtctgcctgtggtactgcaattagacaatcagctcaacaagggcaggttaac
agccatgattctcgaacttctttctcagaagaaagcactcctagcacaagtactaatgtc
caacaggatttgtgcattccattaaacaaccaacagatattgaaacgggtgaaggaatca
tcatatgatttgggaagaaggtactttaggcagcaaaagtggcgtaatacaaagtttggt
cccccttggttacagagaaggagtcaatggggataccagggaaacttcaggagtggttca
agcgctataagtgatgacaatgtactaaacgaggggataaatccatattgctcagatgaa
gcaagcgttagagccgataaagctaacgatgatttttatcagcattcactaaaccagaat
cagcgctga

DBGET integrated database retrieval system