KEGG   Momordica charantia (bitter melon): 111018606Help
Entry
111018606         CDS       T05045                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcha00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    111018606
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111018606
Enzymes [BR:mcha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     111018606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 182 aa AA seqDB search
MASSSIVSSAAVASVNRASPAQASMVAPFTGLKSAAAFPVTRKTNDITTLANNGGRVQCM
KVWPPLGKKKFETLSYLPDMTETQLLKEIDYLIRSGWIPCIEFELEHGFVYREHHKSPGY
YDGRYWTMWKLPMYGCTDASQVVKEIEEAKKEYPSAFIRVIGFDNKRQVQCISFIVYKPS
SY
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcctcaattgtctcatccgcggccgttgcctccgtcaaccgcgcctcccct
gctcaggctagtatggtggcacccttcactggcctcaaatccgccgccgccttccccgtc
acccgcaagaccaacgacatcaccaccctcgccaacaacggcgggagagttcagtgcatg
aaggtgtggcctccacttggaaagaagaagttcgagactctgtcgtacctgcctgatatg
accgaaactcagttgttgaaggaaattgactacctgatccggtctgggtggatcccctgc
attgagttcgagctggagcatggattcgtgtaccgtgagcaccacaagtcaccagggtac
tacgatgggcgctactggaccatgtggaagctgcccatgtacggctgcacagacgcgtct
caggtggtcaaggagatcgaggaggccaagaaggaataccccagcgcattcatcagggtc
attggcttcgacaacaagcgccaagtgcagtgcatcagtttcattgtctacaagccatca
agctactaa

DBGET integrated database retrieval system