KEGG   Mycobacterium chelonae: BB28_18315Help
Entry
BB28_18315        CDS       T04665                                 

Definition
(GenBank) acyl-CoA synthase
Organism
mche  Mycobacterium chelonae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3662168..3663910)
Genome map
AA seq 580 aa AA seqDB search
MQTTRDFTDYFTTVTEWVARQPDRIALGYLEEGAGELAECAWTYAELVSHATAVAARLRE
DLELGDRALLLYPPGLPFVAAFLGCLAAGVVAVPAPLPDGRDKAQHRLAGIIADAGTRVV
LTESSVAPLIAGWADALPTPIALIATDTIQVELGREFVPVRSAPSDTAFLQYTSGSTNAP
KGVIVTHGNLVHNEQELGARIESDPSFSMLSWLPQFHDMGLIGMLLWPLFYGGTSRFLSP
VTFIKHPIQWIRAMSKYRATVGVAPNFAFDLVARRCTQEALEGVDLSSVRSLLNGSEPVQ
WASIERFTTLLAPFGLAEHAVTPVYGLAEATLFVTGDPHGTPVTTAVVDGEALAENRLVV
ADEGVPRSRVLVASGRVGGIEVSVVGADGAPLPDGEIGEIWLRGTSVAAGYWNLPELSAE
IFGATPIGGTGGWLRTGDLGTLVDGNLFITGRTKDVIIVNGRNLYAHDIEAAARAAAPAL
ARGVGAAFAVGTPERLVLVHEIRPENLGDASLDDVLAAVRTAIFAEFATPLSDLVLVAKG
EVARTTSGKIRRTHMRASYEKGRITVFADPRLASAGGDVR
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgacgcgcgatttcaccgactacttcaccaccgtcaccgaatgggttgcccga
caaccggatcggattgccctgggctacctggaagaaggtgccggcgaactggcggagtgc
gcgtggacctatgccgaactcgtaagtcatgccactgcggtggccgcacgccttcgcgaa
gacctggagcttggggaccgtgccctgctgctgtatccgcccgggctgccattcgtcgcg
gcgttccttggctgcttggctgccggagtcgtcgcagttcccgcgcctctgcctgatggt
cgtgacaaggcgcaacaccgtcttgccggaatcatcgcggacgcgggcacacgcgttgtg
ctgacggagtcgtcggttgcgccacttatcgcgggatgggccgatgcgctgcccacgccg
atcgcgctcatcgccaccgataccattcaggtcgagctggggcgcgaattcgtcccggtg
cggtcggcgccttccgataccgccttcctgcagtacacgtcgggttcgaccaatgccccg
aagggtgtgatcgtcacccacgggaacctcgtccacaacgagcaggaactcggagcccgc
atcgagagtgacccgtcgttctcgatgctcagttggttgccgcagtttcatgacatgggg
ctgatcggcatgctgctctggccgttattctatggtggcacttcgcgtttcctgtcaccc
gtcacgtttatcaagcatcccatccagtggatccgggccatgtcgaagtaccgggcgacc
gtcggagtggcaccgaacttcgccttcgacctggtggcacggcgctgcacgcaagaggcg
ctcgagggtgtggacctgtcgtccgtacggtcgttactcaacggatcagagcccgtgcag
tgggcttctatcgagcggttcaccacgctgctggctccgttcggactcgcggagcatgcg
gtcactccggtgtatgggcttgccgaagccacgttattcgtgactggcgacccgcacggc
acgccggttaccaccgccgttgtcgacggggaggcgcttgccgaaaatcggttggtggtc
gcggacgaaggggtgccacgctcccgagtgctggttgccagcggccgcgttggcggtatc
gaagtttcggtcgtcggagccgacggtgcacctcttcccgacggtgaaatcggcgagatc
tggctgcgcggaacgagtgtggctgctgggtactggaaccttccggagttgtctgccgag
atattcggcgcgacaccgatcggcggcacgggcggctggttgcgtaccggggacctgggc
accctggtcgatggcaacctcttcatcaccggtcgcaccaaggacgtcattatcgtcaac
ggccgcaatctctacgcccatgacatcgaggcggccgcgcgtgcggccgccccggcgctg
gcacgcggggtgggcgcggcattcgcggttggcacccctgagcggctcgtactggttcac
gagatccgtccggagaaccttggtgatgcctctcttgacgacgtgctcgcggcggtacgc
accgcgatattcgccgaattcgccaccccgctcagcgatctggtgctggtggccaagggg
gaggtagcccgtaccaccagtggcaagatccgtagaacccatatgcgagcctcctacgag
aagggccggatcacggtgtttgcggatccgcggctggcctccgccggtggggacgtccgg
tga

DBGET integrated database retrieval system