KEGG   Mycobacteroides chelonae: BB28_22625Help
Entry
BB28_22625        CDS       T04665                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mche  Mycobacteroides chelonae
Pathway
mche00250  Alanine, aspartate and glutamate metabolism
mche00410  beta-Alanine metabolism
mche00640  Propanoate metabolism
mche00650  Butanoate metabolism
mche01100  Metabolic pathways
mche01120  Microbial metabolism in diverse environments
Module
mche_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mche00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BB28_22625
   00650 Butanoate metabolism
    BB28_22625
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BB28_22625
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BB28_22625
Enzymes [BR:mche01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BB28_22625
Amino acid related enzymes [BR:mche01007]
 Aminotransferase (transaminase)
  Class III
   BB28_22625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF982
Motif
Other DBs
NCBI-ProteinID: ANB00353
LinkDB All DBs
Position
complement(4542213..4543418)
Genome map
AA seq 401 aa AA seqDB search
MVAVRGQGCYLYDESDREYLDFTAGIGVVSTGHCHPRVVEAAQRQVATLIHGQYTTVMHR
PLQNLVRRLGDVLPADLDSLFFANSGSEAIEASVRLARQATGRPNIVVFQGGFHGRTLAA
ATMTTSGPRFSSGIGPLMAGVYTAPFPTAYRYGWSETEATRFALQELDYLLATATAPNQV
AALVIEPVLGEGGYIPANTEFLNGVAERAHQHGILLVVDEVQTGFGRTGEYFGHQHFGVT
PDILVMAKGIASGFPISGIAASAELMGRAWPGSQGGTYGANAVACAAALATLDVIDEERL
VENARARGRELLDGARKIAAERGIDGDVRGLGLMVGVEFSADGRPAAQLAARAQALAAEK
GLLLLMCGPHMNVVRMIPPLVVTADQISDALGIWSTVLAEL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtggtggcggtgcgaggccagggttgctatctgtatgacgaaagtgaccgtgaatacctg
gatttcactgcgggtatcggtgtcgtgagtacgggtcactgccatcctcgtgtggtcgag
gccgcgcaacggcaggtggccacgctcattcacgggcagtacaccacggtgatgcatcga
ccattgcagaacctggtgcgccgtcttggtgatgtgttgcctgcggatctggattcgttg
ttcttcgccaactccggtagtgaggccatcgaggcctccgtgcggttggcgcggcaggcc
accggccgcccgaacatcgttgtgttccaaggtggatttcacggacgtaccctggccgcg
gccaccatgaccacctcggggccacgattctcatcgggaatcggccccttgatggccggc
gtgtacacggctcctttcccgacggcgtatcggtatggctggagcgagaccgaggccacc
cggttcgcgctgcaagagctggactacctgctcgccaccgcgacggcacccaatcaggtg
gcagcgctggtcatcgaaccggtgttgggagagggcggttacatccccgccaacaccgag
ttcctcaacggcgtcgccgaacgcgctcaccagcacggcatcctgctggtggttgacgag
gtgcagaccggattcggccgcaccggagagtatttcggccaccagcactttggcgtgacg
ccagacatcctggtgatggccaagggaatcgccagcggattccccatctcaggtatcgcg
gcctctgccgagctgatggggcgtgcctggcccggttcacagggcggcacctatggcgcc
aatgccgttgcctgtgcggctgcgcttgcgaccctcgacgtgatcgacgaggaacggctc
gtcgagaacgctcgggcgcggggccgggagcttctcgacggtgcgcgaaagatcgctgcc
gagagagggattgatggcgatgtgcgtggcctggggttgatggtaggtgtggagttcagt
gcggacggccgacctgcggcccagctcgccgcccgggcccaggcattagcggccgagaag
gggctgctcctgctgatgtgcggtccacatatgaatgtggtgcggatgattccaccattg
gtagtgacggccgatcagatatccgatgccctgggcatctggagcaccgtgttggcggag
ctgtga

DBGET integrated database retrieval system