KEGG   Mycobacterium chimaera: AN480_01625Help
Entry
AN480_01625       CDS       T04926                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mchi  Mycobacterium chimaera
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AOS90458
UniProt: A0A1Y0SWT7
LinkDB All DBs
Position
complement(334556..335626)
Genome map
AA seq 356 aa AA seqDB search
MDLPVMPPVSPMLAKSVRAIPPHASYEPKWDGFRSICFRDGDDVELGSRNERPMTRYFPE
LVAAVRAELPERCVIDGEIVIATDHGLDFEALQQRIHPADSRVRMLAEATPASFIAFDLL
ALGGDDYTRRPFSERRAALVDAVGGSGRSIHVTPATTDLGTAQRWFDEFEGAGLDGVIAK
PLDVTYQPDKRVMFKIKHERTADCVVAGYRVHKSGADAIGSLLLGLYQDDGQLASVGVIG
AFPMAERRRLFAELQPLVTDFADHPWNWAAHEAGERTPRKNEYSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGRRFRHTAQFNRWRPDRDPRSCTYQQLEQPVTFSLGEIVPGLGPG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggacctccctgtcatgccgccggtgtcgccgatgctggccaagtcggttcgcgctatc
ccgccccacgcgtcgtacgagcccaagtgggacggattcaggtcgatctgtttccgtgac
ggcgacgacgtcgagctcggcagccgcaacgagcggccgatgacccgctactttccggag
ttggtcgccgcggtcagggccgagctgccggagcgctgcgtgatcgacggggagatcgtc
atcgccaccgaccacggcctggacttcgaggcgctgcagcaacgcattcacccggccgac
tcgcgggtgcggatgctcgccgaggcgacgcccgcgtccttcatcgcgttcgacctgctg
gcgctcggcggcgacgactacacccggcggccgttcagcgagcggcgggcggccctcgtc
gatgcggtgggcggatcgggtcgctcgatccatgtcacgcccgcgacgaccgatctgggc
accgcgcagcgatggttcgacgagttcgagggcgccggcctcgacggcgtgatcgccaag
cccctcgacgtcacctaccagccggacaagcgggtgatgttcaagatcaagcacgaacgg
accgcggactgtgtggtcgccggctatcgggtgcacaagtctggcgccgacgcgatcggg
tcgctgttgctggggctctaccaggacgacggccagctcgcgtccgtcggcgtcatcggc
gcgttcccgatggccgagcggcgccgcctgttcgccgaactgcagccgctcgtcaccgac
ttcgcggaccatccgtggaactgggccgcccacgaggccggcgagcggacgccccgcaag
aacgaatactcgcggtggaacgccggcaaggacctctcgttcgtgccgctgcggcccgag
cgcgtggtcgaagtccgctacgaccacatggagggtcggcgctttcgtcataccgcgcag
ttcaatcggtggcgtccggaccgcgacccgcgctcgtgcacctaccagcagctggaacag
ccggtgacgttcagcctcggcgagatcgtgccgggcctcggcccgggctaa

DBGET integrated database retrieval system