KEGG   Mycobacterium chimaera: AN480_15575Help
Entry
AN480_15575       CDS       T04926                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mchi  Mycobacterium chimaera
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3462894..3463892
Genome map
AA seq 332 aa AA seqDB search
MTDFASLPGAVREALYDEPVPDWRSPTLATLTDDRFSDPHWIFERKFDGMRCLAFRDGDR
VRLVSRNRQPLNGTYPELVNALAAQPVTRFVVDGEVVAFDGRRTSFARLQGRLGLTDPDV
ARASPVRVFYYVFDLLHLDGMSTVEVPLLWRKRLLRRAIDFADPLRCAPHRVGDGIAAYR
RACERGDEGVIAKRADSTYQSGRSKNWLKFKCVRDQEFVVGGYTSPKGSRVELGALMLGY
YEGGDLVYAGKVGTGFDDATLRRLHARLSPITRDTPPFARGLVREAGANWVSPEMVVQIG
FSEWTRDGKLRHPRYLGMRTDKEPGDVVRETH
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacggacttcgcgagcctgcccggtgcggtgcgcgaagcgctgtacgacgaacccgtg
cccgactggcgctcgcccaccctggccaccctcaccgacgaccggttctccgatccgcac
tggatcttcgagcgcaagttcgacggcatgcgatgcctggcgttccgcgacggcgatcgg
gtgcggctggtgtcgcgtaatcgtcagccgctcaatggaacctatcccgaattggtgaat
gcgcttgccgcccaaccggtcacgcggttcgtcgtggacggagaggtggtggccttcgac
ggccggcggaccagcttcgcccggctgcagggtcggctgggcctcaccgaccccgacgtg
gcccgggcgtcgccggtgcgtgtcttctactacgtgttcgacctcctgcatctcgacggc
atgtccaccgtcgaggtgccgctcctgtggcgaaagaggttgctgcgcagagcgatcgac
ttcgccgacccgctgcgctgtgcgccgcaccgcgtcggggacgggatcgccgcctaccgg
cgcgcatgtgaacgcggggacgagggagtgatcgccaagcgggccgactccacctaccag
agcggtcgctcgaagaactggctgaagttcaaatgcgtgcgcgatcaggagttcgtggta
gggggctacaccagtcccaagggcagtcgcgtcgagttgggcgccctgatgctcggctac
tacgagggcggcgacctggtctacgcgggcaaggtcggcaccggtttcgacgacgccacg
ctgcgccgcctgcacgcgcgcctgtcgccgatcacccgggacacgccgccgttcgcccgc
ggtttggtgcgcgaggccggcgcgaactgggtatcccccgagatggtggttcagatcgga
ttcagcgagtggacgcgcgatggcaagttgcgccatccgcgctacctcggcatgcgcacc
gacaaggagcccggcgacgtggtgcgggagacgcactga

DBGET integrated database retrieval system