KEGG   Mesorhizobium ciceri: Mesci_0523Help
Entry
Mesci_0523        CDS       T01401                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
mci  Mesorhizobium ciceri
Brite
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Mesci_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(567891..568595)
Genome map
AA seq 234 aa AA seqDB search
MADLSAFPIATRWPAKHPDQLQLYSATTPNGVKISIALEELGLPYEPHWVNIGQNESWTP
EFLSLNPNGKIPAIIDPNGPDGQPIGLFESGAILLYLAEKTGLLMPIDGARRYETIQWVF
FQMASVGPMFGQVGFFHKFAGREIADKRPLERYRDESKRLLGVLDGRLKGRKWIMGNDYT
IADISLLGWVRNLIGFYEARELVGFDDFAHLGTWLERGLARPAVQKGLTVPAKG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcagacctgtccgcctttccgatcgcaacgcgttggccggccaagcatccggaccag
ctccagctctattcggcgacaacgccgaacggggtgaagatatcgatcgccctggaggaa
ctcggccttccttacgagccgcattgggtcaacatcggccagaacgaaagctggacaccg
gaattcctgtcgctcaatcccaacggcaagataccggcgatcatcgatcccaacggcccg
gacggccagccgatcggcctgttcgaatccggcgccatcctgctctaccttgctgaaaag
accggcctgctcatgcccattgatggcgcgcgccgctacgagaccatccagtgggtgttc
ttccagatggcctcggtcgggccgatgttcggccaggtcggcttcttccacaaattcgcc
ggccgcgaaatcgccgacaaacgccctctggagcgctatcgcgacgagtcaaagcgactg
ctcggcgtgctcgacggccggctgaaagggcgcaagtggatcatgggcaatgactacacc
atcgccgacatctcgctgctcggttgggtgcgcaacctgatcggattctacgaagcgcgc
gaactcgtcggctttgacgatttcgcccatctgggaacatggctggagcgcggcctggcg
cggccggcggtgcaaaaaggcctgaccgtcccggccaagggatag

DBGET integrated database retrieval system