KEGG   Mycobacterium canettii CIPT 140070008: BN43_70099Help
Entry
BN43_70099        CDS       T02420                                 

Gene name
gadB
Definition
(GenBank) Putative glutamate decarboxylase GadB
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
mcv00250  Alanine, aspartate and glutamate metabolism
mcv00410  beta-Alanine metabolism
mcv00430  Taurine and hypotaurine metabolism
mcv00650  Butanoate metabolism
mcv01100  Metabolic pathways
mcv01110  Biosynthesis of secondary metabolites
mcv01120  Microbial metabolism in diverse environments
mcv02024  Quorum sensing
Module
mcv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mcv00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BN43_70099 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN43_70099 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN43_70099 (gadB)
   00430 Taurine and hypotaurine metabolism
    BN43_70099 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BN43_70099 (gadB)
Enzymes [BR:mcv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BN43_70099 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CCK57499
LinkDB All DBs
Position
complement(3875074..3876459)
Genome map
AA seq 461 aa AA seqDB search
MSRSHPSVPTHSIAPAYTGRMFTAPVPALRMPDESMDPEAAYRFIHDELMLDGSSRLNLA
TFVTTWMDPEAERLMAETFDKNMIDKDEYPATAAIEARCVSMVADLFHAEGLRDHDPASA
TGVSTIGSSEAVMLGGLALKWRWRQRVGADWKGRTPNLVMGSNVQVVWEKFCRYFDVEPR
YLPMEKGRYVITPEQVLAAVDENTIGVVAILGTTYTGELEPIAEICAALDKLAAGGGVDV
PVHVDAASGGFVVPFLHPDLVWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRGPEHLPED
LVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRDGYTKVMQALSHTARWLGDQLR
EVDHCEVISDGSAIPVVSFRLAGDRGYTEFDVSHELRTFGWQVPAYTMPDNATDVAVLRI
VVREGLSADLARALHDDTVTALTALDKVKPGGHFDAQHFAH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcgcagtcacccgtccgtgcccacgcactcgatcgctcccgcctacaccggccgg
atgttcaccgccccggtgccggcgctgcggatgcccgatgagtcgatggatcccgaggcg
gcctatcgcttcatccacgacgagctgatgctcgacggtagctcgcggctgaacctggcc
accttcgtgaccacctggatggacccggaggccgaaaggctgatggccgagacgttcgac
aagaacatgatcgacaaggacgagtacccggcgaccgcggccatcgaagcgcgctgtgtg
tccatggtcgccgacctgtttcacgccgagggtctgcgcgaccacgatcccgccagcgcg
accggggtgtccaccatcggctccagcgaggcggtgatgctgggcggtcttgctctgaaa
tggcggtggcggcaacgggtcggtgccgactggaaagggcgcaccccaaacctggtgatg
ggttcgaacgtccaggtggtgtgggagaagttctgccgctacttcgacgtcgaaccccgt
tacctgccgatggaaaagggccgctacgtcattacccccgagcaggtgctcgccgccgtc
gacgagaacaccatcggcgtggtggcgatcttgggcaccacctataccggtgaactcgaa
cccatcgccgagatctgcgccgcgctggacaaactggcggctggcgggggtgtggacgtc
ccggtgcacgtcgacgccgccagtgggggctttgtggtgccgtttttgcatcctgacctg
gtgtgggattttcggctgccccgggtggtgtcgatcaacgtcagcggccacaagtatggg
ctgacctatcccggtgtcgggtttgtcgtgtggcgcggccccgagcacctgccggaggat
ctggttttccgggtcaactacctcggcggcgacatgccgaccttcaccctgaacttctcc
cgtcccggtaatcaggtggtgggccagtactacaacttcttgcggctggggcgcgacggc
tataccaaggtgatgcaggcgctgtcgcacaccgcccgctggttgggtgaccagctgcgc
gaggtggatcattgcgaggtgatctcggatggttcggcgatcccggtggtcagcttccgg
ctcgccggtgaccgcgggtacacggagttcgatgtctcccacgagctgcggaccttcggg
tggcaggtgcccgcctacaccatgccggacaacgccaccgacgtggcggtgctgcggatc
gtggttcgggaaggactctcggctgacctggcgagggccctgcacgacgacaccgttacc
gcgttgacggccctggacaaggtcaagccgggtggccacttcgacgcacagcatttcgcg
cactag

DBGET integrated database retrieval system