KEGG   Microbacterium chocolatum: A8L33_08300Help
Entry
A8L33_08300       CDS       T04340                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mcw  Microbacterium chocolatum
Pathway
mcw00010  Glycolysis / Gluconeogenesis
mcw00030  Pentose phosphate pathway
mcw00051  Fructose and mannose metabolism
mcw00052  Galactose metabolism
mcw00680  Methane metabolism
mcw01100  Metabolic pathways
mcw01110  Biosynthesis of secondary metabolites
mcw01120  Microbial metabolism in diverse environments
mcw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mcw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A8L33_08300
   00030 Pentose phosphate pathway
    A8L33_08300
   00051 Fructose and mannose metabolism
    A8L33_08300
   00052 Galactose metabolism
    A8L33_08300
  Energy metabolism
   00680 Methane metabolism
    A8L33_08300
Enzymes [BR:mcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A8L33_08300
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     A8L33_08300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ANG85387
UniProt: A0A0M8MNB9
LinkDB All DBs
Position
1758694..1759722
Genome map
AA seq 342 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGAVLKGTTTYDLEFVGIRDGWRGVVDGDFFPLTRHEVKGL
SKVGGTILGTSRTNPYEGPRGGAENIAKTMYGHRLDGIVAIGGEGTLAAANRLAGDGINV
IGVPKTIDNDLRATDYSFGFDTAVNIATDAMDRLRTTGDSHQRCMVAEVMGRHVGWIALH
AGIAAGAHVICIPEVPLSIEEITQQVTRAHDRGRAPLVVVSEGFKLKDMDEAYSDKGLDA
FNRPRLGGISEILAPEIERITGIETRATVLGHIQRGGSPSGFDRVLATRLGLHTADAIVQ
EAWGQMVALRGTDIVRVPFADALGELNSVPLYRYEEAAALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggcatcctgaccagcggcggtgactgccccggactcaacgcggtgatccgc
ggcgccgtgctcaagggcacgaccacgtacgacctggagttcgtcggcatccgtgacgga
tggcgcggcgtggtggatggcgacttcttcccgctgacccggcacgaggtgaagggtctg
tccaaggtcggcgggacgatcctcggcaccagccgcaccaacccctacgagggcccgcgc
gggggtgccgagaacatcgccaagacgatgtacggccaccgcctcgacggcatcgtcgcg
atcggcggcgagggcaccctcgccgcggcgaaccggctcgccggcgacggcatcaacgtc
atcggcgtgccgaagacgatcgacaacgacctgcgggccacggactactcgttcggattc
gacaccgcggtcaacatcgccaccgacgcgatggaccggctccgcacgaccggtgattcg
caccagcgctgcatggtcgccgaggtcatggggcgccacgtcggctggatcgccctgcac
gccggcatcgccgccggcgcccatgtcatctgcatccccgaggtgccgttgtctatcgag
gagatcactcagcaggtcacccgggcgcacgaccgcggccgtgcgccgctggtggtggtg
tcggagggcttcaagctcaaggacatggacgaggcttacagcgacaaggggctggacgcg
ttcaaccgcccgcgtctcggcggcatcagcgagatcctcgctcccgagatcgaacggatc
accggaatcgagacccgggccaccgtgctcggccacatccagcgcggcggctcgccgtcg
ggcttcgaccgggtcctggccacccgcctgggcctgcacactgcggacgcgatcgtgcag
gaggcgtgggggcagatggtggcgctccgcggcaccgacatcgtgcgcgtgccgttcgcc
gacgccctcggcgagctgaactccgtgcccctctaccgctacgaagaggccgccgccctc
ttcgggtga

DBGET integrated database retrieval system